KEGG   Candidatus Blochmannia chromaiodes (Camponotus chromaiodes): BCHRO640_453Help
Entry
BCHRO640_453      CDS       T02430                                 

Gene name
trpC
Definition
(GenBank) Tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
bchr  Candidatus Blochmannia chromaiodes (Camponotus chromaiodes)
Pathway
bchr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bchr01100  Metabolic pathways
bchr01110  Biosynthesis of secondary metabolites
bchr01130  Biosynthesis of antibiotics
bchr01230  Biosynthesis of amino acids
Module
bchr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bchr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCHRO640_453 (trpC)
Enzymes [BR:bchr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BCHRO640_453 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     BCHRO640_453 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AGC03704
UniProt: L0MUZ3
Position
521686..523056
Genome map
AA seq 456 aa AA seqDB search
MQHTILDKILSYKKMWIADQKKQHSLHFLKSKTQASNRDFYSAVSRNKYQTIFILECKKA
SPSKGIICNDFDPIKIAQTYKNYSSVISVLTDNKYFHGNFNILHQVSNIVKQPILCKDFF
ISEWQIYFARLHKADAILLMLSILDDASYQKLVKIAHTLCMGVLTEIANEDELKRAKYLG
AKVIGINNRNLNDLSVDLNRTITLSKDIPNTITVISESGISNYCHIRKLRRYVNGFLIGT
ILMSQPKLNTAIKKLILGENKICGLTRVRDADIAYKSGAIYGGLIFVPTSPRYINITIAQ
RIVSCVKHLSYVGVFCNAPISYIVTMVTILGLAAVQLHGVEDQDYINILRTRLPITCHIW
KSINMNHRPLSKCNILNVDRYLADSGGGSGKTFDWSLLSSMQLDKVILAGGLTINNCNKA
ARIGCLGLDFNSGVEIKPGIKNHQKLIKVFQIIRSY
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacacaatactcgataaaattttatcatataaaaaaatgtggatagctgatcaa
aaaaaacagcattcattacattttttaaaaagtaaaacacaagcaagcaatcgtgatttt
tatagcgctgtgtctcgcaataaatatcaaacaatatttatattagaatgtaagaaagcg
tctccttctaaaggtattatttgtaatgattttgatcctatcaaaatagcgcagacttat
aaaaattactcctcagtgatatcagtattaactgataataaatattttcatgggaatttt
aatattttacaccaagtgagtaacattgtaaaacaaccaatattatgtaaagatttcttt
atttcagaatggcaaatttattttgcgcgcttacataaagctgatgctattttactaatg
ctatcaattctagatgatgcatcctatcaaaaattggtcaaaatagctcatacattatgt
atgggggtactaacagaaatcgcaaacgaagatgaattaaagcgcgctaaatatttagga
gctaaagttatcggtataaataatcgtaatctgaatgatttgtccgttgatttaaatcgc
actattactctaagtaaagatatacctaacacaatcactgtaatcagcgagtctggtatt
agcaattattgtcatataagaaaacttagacgatatgttaatggatttttaataggtaca
atattaatgtctcaaccaaagcttaatacagccattaaaaaattaattttaggagaaaat
aaaatatgtggactaactcgagtgagagacgctgatattgcatacaaatcaggcgcaata
tatggagggctaatttttgttcccacttcacctcgctacataaatatcacaattgcgcaa
cgtattgtttcttgtgtaaaacatttaagttatgttggtgtgttttgtaatgctccaatt
tcttatattgttaccatggttaccatattaggactagcagcagttcagcttcatggagta
gaagatcaagattatattaatattttacggacacgattacccataacatgtcatatatgg
aaaagtattaatatgaatcacagaccattgtcgaaatgtaatatactgaacgtagatcgc
tatttagcagatagtggagggggtagtggaaaaacttttgattggtcactgctttctagc
atgcaattagataaagtaattttagccggaggattgacaataaacaattgtaataaagcg
gcgcgcataggttgtttaggtttagattttaattctggagttgaaattaaaccaggtatt
aaaaatcaccagaaactcatcaaagtcttccaaataatcaggtcttattaa

DBGET integrated database retrieval system