KEGG   Candidatus Blochmannia chromaiodes: BCHRO640_549Help
Entry
BCHRO640_549      CDS       T02430                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bchr  Candidatus Blochmannia chromaiodes
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bchr01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bchr00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
639597..640751
Genome map
AA seq 384 aa AA seqDB search
MNYSALITLAQKLIQQPSVSPNHHSCHEIIANYLEKLNFNVELMRFDNTLNLWAFHSCKK
QQKHTTLLFIGHTDVVDPGDPQYWDYPPFSGLVHNNILHGRGAIDMKGALAAMLVASANF
IDQHPNYQGRIAFLITSDEEGSGLNGTTKVVESLIARNEHINYCIVGEPSSQDQLGDVIK
NGRRGSLTGQLTIHGSPGHVAYPQFSKNPIHLIIPALSDLLNITWDQEKSILFPPTAMQI
TNIYSNHKNNNVTPHTVILNFNVRFNDKCSIDNIKRYINDIFTRHTLLYNINWKLSAEPY
FSKPGQLTNVAINAIKYYQKFEPRLETTGGTSDGRFIAKMGTEVIELGARNHMIHKVNEY
IDLIDLKLLSSIYKKIIEDLILIQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaattattcagcgctaataacattagctcaaaaattaattcagcaaccttcggttagc
ccaaaccatcatagttgtcatgaaataattgcaaattatttagaaaaactaaattttaat
gtagagttaatgcgctttgataacacccttaatctttgggcatttcatagttgtaaaaaa
caacaaaaacacaccacattattgtttattgggcatactgatgtggtcgatcctggagat
cctcaatactgggattaccctccgttctcaggattagtacataataatatattacatggg
cgaggcgcaattgatatgaaaggggcattagcagctatgttagtagcctctgccaatttt
atcgaccaacatcctaattatcaagggcggattgcatttcttatcacttctgacgaagaa
ggcagtggtctcaacggaaccacaaaagttgtagaatctctaattgcacgtaatgaacat
ataaactattgcatagtcggagaaccatccagtcaagatcaactaggtgatgttataaaa
aatggtagacgtggatcacttactggacaactgacaatacatggatctccaggacatgtc
gcatatcctcaattctctaaaaatccaatacatttaatcattccagcactatcagattta
ctaaacattacatgggatcaagaaaaaagtatattatttcctcctactgctatgcaaatt
actaatatttattctaatcataagaacaacaatgttacaccccatacagttatattaaat
tttaatgtacgctttaatgataaatgttctattgacaatattaaaagatacataaatgac
atattcacacgtcatactttactttataatatcaattggaaactttctgcagagccttat
tttagtaaacctggacaattaactaacgttgcaatcaatgcaattaaatattaccaaaaa
tttgaacctcgattagaaactacaggaggtacttctgatggacgttttatagctaaaatg
ggaacagaagtcatagaattaggagcacgtaaccatatgattcataaagttaacgaatat
attgatctaattgatttaaaattacttagctctatatataaaaaaattatagaagattta
atactaatacaataa

DBGET integrated database retrieval system