KEGG   Candidatus Blochmannia chromaiodes (Camponotus chromaiodes): BCHRO640_549Help
Entry
BCHRO640_549      CDS       T02430                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bchr  Candidatus Blochmannia chromaiodes (Camponotus chromaiodes)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bchr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCHRO640_549 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BCHRO640_549 (dapE)
Enzymes [BR:bchr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BCHRO640_549 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
639597..640751
Genome map
AA seq 384 aa AA seqDB search
MNYSALITLAQKLIQQPSVSPNHHSCHEIIANYLEKLNFNVELMRFDNTLNLWAFHSCKK
QQKHTTLLFIGHTDVVDPGDPQYWDYPPFSGLVHNNILHGRGAIDMKGALAAMLVASANF
IDQHPNYQGRIAFLITSDEEGSGLNGTTKVVESLIARNEHINYCIVGEPSSQDQLGDVIK
NGRRGSLTGQLTIHGSPGHVAYPQFSKNPIHLIIPALSDLLNITWDQEKSILFPPTAMQI
TNIYSNHKNNNVTPHTVILNFNVRFNDKCSIDNIKRYINDIFTRHTLLYNINWKLSAEPY
FSKPGQLTNVAINAIKYYQKFEPRLETTGGTSDGRFIAKMGTEVIELGARNHMIHKVNEY
IDLIDLKLLSSIYKKIIEDLILIQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaattattcagcgctaataacattagctcaaaaattaattcagcaaccttcggttagc
ccaaaccatcatagttgtcatgaaataattgcaaattatttagaaaaactaaattttaat
gtagagttaatgcgctttgataacacccttaatctttgggcatttcatagttgtaaaaaa
caacaaaaacacaccacattattgtttattgggcatactgatgtggtcgatcctggagat
cctcaatactgggattaccctccgttctcaggattagtacataataatatattacatggg
cgaggcgcaattgatatgaaaggggcattagcagctatgttagtagcctctgccaatttt
atcgaccaacatcctaattatcaagggcggattgcatttcttatcacttctgacgaagaa
ggcagtggtctcaacggaaccacaaaagttgtagaatctctaattgcacgtaatgaacat
ataaactattgcatagtcggagaaccatccagtcaagatcaactaggtgatgttataaaa
aatggtagacgtggatcacttactggacaactgacaatacatggatctccaggacatgtc
gcatatcctcaattctctaaaaatccaatacatttaatcattccagcactatcagattta
ctaaacattacatgggatcaagaaaaaagtatattatttcctcctactgctatgcaaatt
actaatatttattctaatcataagaacaacaatgttacaccccatacagttatattaaat
tttaatgtacgctttaatgataaatgttctattgacaatattaaaagatacataaatgac
atattcacacgtcatactttactttataatatcaattggaaactttctgcagagccttat
tttagtaaacctggacaattaactaacgttgcaatcaatgcaattaaatattaccaaaaa
tttgaacctcgattagaaactacaggaggtacttctgatggacgttttatagctaaaatg
ggaacagaagtcatagaattaggagcacgtaaccatatgattcataaagttaacgaatat
attgatctaattgatttaaaattacttagctctatatataaaaaaattatagaagattta
atactaatacaataa

DBGET integrated database retrieval system