KEGG   Baumannia cicadellinicola: BCI_0062Help
Entry
BCI_0062          CDS       T00349                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bci  Baumannia cicadellinicola
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCI_0062 (hemD)
Enzymes [BR:bci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BCI_0062 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
73173..73913
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPAGEKLVEKLRAYGKLAWHLPLIRFLPGMDLPMLGRHFMALCQDDLLFILS
QHAIVYAHSWLLQQSINWPARLRYFTVGSTSGLLLHQFSGLPVNYPHQCETSEGLLNLPS
LASIDGRRALILRGNGGRKILKQTLLQRGVKVEDCECYRRYPIPYDGNEQGRRLLSLGIN
TLVITSGEMLQQFYTLIPKSYHYFLLIQCRLIVVSERLAILAHKLGWQDIIIVNITDHDA
LMRVLR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcttagttacacgaccttctcctgcgggggagaagctcgtagagaaactacgc
gcttatggtaaattagcctggcatctaccgcttattcgctttttacctggtatggatctc
cctatgttaggaagacattttatggctctttgtcaagatgatttgctgtttattttatca
caacatgctattgtatatgctcattcttggttactacagcaaagtattaattggccggca
agactacgatatttcactgttggtagtactagcggattactattacatcagtttagtggt
ttaccggtaaactatccacaccaatgtgaaactagcgaaggattactaaatttaccttct
cttgcttctatcgatgggcggcgtgcgctaatattacgtggtaatggaggaagaaaaata
ctaaaacaaacgctcctacagcgaggagtaaaagtggaagattgtgaatgttatcgtcga
taccctattccttatgatgggaatgaacaaggtcgtcgcttactatcgcttgggataaat
acattagtaatcactagtggtgaaatgttgcaacaattctatactttaatccccaaaagt
tatcactattttttactaatccaatgtagattaatagtagtaagtgaacgtttagctatc
cttgctcataaattaggctggcaagatattatcatcgttaatattacagatcatgatgct
ttaatgcgcgtattacggtaa

DBGET integrated database retrieval system