KEGG   Baumannia cicadellinicola Hc (Homalodisca coagulata): BCI_0097Help
Entry
BCI_0097          CDS       T00349                                 

Gene name
sucC
Definition
succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bci  Baumannia cicadellinicola Hc (Homalodisca coagulata)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCI_0097 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCI_0097 (sucC)
   00640 Propanoate metabolism
    BCI_0097 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BCI_0097 (sucC)
Enzymes [BR:bci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BCI_0097 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
106173..107354
Genome map
AA seq 393 aa AA seqDB search
MKLHEYQAKMLFAQYGIPIPKGLVCTTPNEAKESIAVIGYGPWIVKCQVHAGGRGKSGGV
RIVRSKEEIQEFAKQWFGKHLITEQTNHIGQPVSKILVEAAIDIAQELYLGCLVDRSNQC
IKFIASIQGGIDIENIAKEKPHLLHQIILDPLIGPQLYQSRDLAFKIGLSSKKQINQFNK
IFMGLATLFLEKDLVMAEINPLVITRLGDLICLDGKLHVDSNALFRQPELCKMLDPSQED
KCETYAKQHNLNYIALNGNIGCLVNGAGLAMSTIDMVKFYGGEPANFLDVGGRVTQEKVT
KAFQIILSDKKVKVILVNIFGGIVCCDVIAKGIINARLESGINIPVIVRLEGNNAKQGIQ
HLVNSILNIRIATNLTTAAKQAVALVEGKQCLF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaagctacatgaatatcaggcaaaaatgctctttgctcagtatggtatacctatacct
aaaggattagtttgtacaacaccaaatgaagcaaaagagtcaattgctgttattggttat
ggtccttggatagtaaaatgtcaagtacatgcaggtggtagaggtaaatctggtggagtt
aggattgttagatcaaaagaagaaatccaagaatttgctaaacagtggtttggtaagcat
cttattactgaacaaactaaccatataggtcaaccagttagtaagattttagtggaagct
gctattgatattgctcaagaattatatttaggttgcttagtagatcgtagtaatcagtgt
attaaatttatagcatctatacaaggaggtatagatattgagaacattgcaaaagaaaaa
ccacatcttcttcatcaaattatattagatccactaataggtccacagttataccaaagt
cgtgatctagcttttaaaataggtctatcaagtaaaaaacaaattaaccaatttaataaa
atttttatgggattagcaaccttatttttagaaaaagacctagtaatggcagaaattaat
ccgctggttattactcgtttaggcgatctaatttgcttagatggtaagctacatgttgat
agcaatgctctattccgtcaacctgaactatgtaaaatgcttgatcctagtcaggaagat
aagtgcgaaacttatgctaaacaacataatcttaattatatagctctaaatggtaatata
ggttgtctggtcaacggagctggcttagcaatgagcactatagatatggtaaaattctat
ggtggagaaccagctaactttttagatgtaggtggtagagttactcaagaaaaggttact
aaagcatttcaaattatactttcagacaaaaaagtaaaagtcatactagtaaatattttt
ggtggtattgtttgttgtgatgtaatagctaaaggtattattaatgctagattagaatct
ggcattaatatacctgttatcgtccggttagaaggtaataacgcaaaacaaggtattcaa
catttagtaaatagtatcttaaatataagaatagctactaatttaactactgccgctaaa
caagcggtagctttagttgagggtaagcaatgtctattctaa

DBGET integrated database retrieval system