KEGG   Baumannia cicadellinicola Hc (Homalodisca coagulata): BCI_0169Help
Entry
BCI_0169          CDS       T00349                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bci  Baumannia cicadellinicola Hc (Homalodisca coagulata)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCI_0169 (tpiA)
   01230 Biosynthesis of amino acids
    BCI_0169 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCI_0169 (tpiA)
   00051 Fructose and mannose metabolism
    BCI_0169 (tpiA)
   00562 Inositol phosphate metabolism
    BCI_0169 (tpiA)
Enzymes [BR:bci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BCI_0169 (tpiA)
Exosome [BR:bci04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BCI_0169 (tpiA)
  Exosomal proteins of bladder cancer cells
   BCI_0169 (tpiA)
  Exosomal proteins of melanoma cells
   BCI_0169 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
187374..188144
Genome map
AA seq 256 aa AA seqDB search
MRHPLVIGNWKLNGSKHMVSNFIISLRNQLSNMINCCNVAIAPPMIYLDRAKSYLTGSHI
ALGAQNVDLHVSGAFTGEISAKMLKDIGAKYIIIGHIERRLYHKESNEDIANKFACLKNE
GLIPVLCIGETKEENEKDQTKAICVRQLDYILNIVGTQAFKNAVIAYEPIWAIATGKSAN
PLQIQKIHKFIRSYLFNHDQAIAEQVIIQYGGSVNASNAAELFNQPDVDGALVGGASLKA
DIFATIIKAAARAKKN
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccgttagttattggtaactggaaactaaacggtagtaaacatatggttagc
aattttatcatatcactccgtaatcaattaagtaatatgattaactgctgcaacgttgct
atagccccaccaatgatatatttggacagagctaaatcttatttaactggtagccatata
gctctaggagcgcaaaatgttgatctccatgtttctggtgcatttactggtgaaatttcg
gctaagatgcttaaagatattggcgctaaatatattattattggccatattgaacgtcgc
ttataccataaagaaagcaatgaggatatagctaataaatttgcttgcctaaaaaatgaa
ggacttattcctgttttatgtattggagaaactaaagaagagaatgaaaaagatcagact
aaagctatttgcgtccgtcagcttgactatattctcaatatagtaggtactcaagcgttt
aaaaatgcagtcatagcctatgagcctatttgggcaattgctaccggaaaatccgctaat
ccgttacagatacagaaaatacataaatttataagaagctatcttttcaatcatgatcag
gctatagcagagcaggttataattcaatacggaggatcagtaaatgctagtaatgcagct
gagctgtttaaccaaccagatgttgatggcgcattagttggcggtgcatcgctgaaagct
gatatctttgctactatcattaaggcagctgcacgagcaaaaaaaaactaa

DBGET integrated database retrieval system