KEGG   Baumannia cicadellinicola Hc (Homalodisca coagulata): BCI_0169Help
Entry
BCI_0169          CDS       T00349                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bci  Baumannia cicadellinicola Hc (Homalodisca coagulata)
Pathway
bci00010  Glycolysis / Gluconeogenesis
bci00051  Fructose and mannose metabolism
bci00562  Inositol phosphate metabolism
bci01100  Metabolic pathways
bci01110  Biosynthesis of secondary metabolites
bci01120  Microbial metabolism in diverse environments
bci01130  Biosynthesis of antibiotics
bci01200  Carbon metabolism
bci01230  Biosynthesis of amino acids
Module
bci_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCI_0169 (tpiA)
   00051 Fructose and mannose metabolism
    BCI_0169 (tpiA)
   00562 Inositol phosphate metabolism
    BCI_0169 (tpiA)
Enzymes [BR:bci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BCI_0169 (tpiA)
Exosome [BR:bci04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BCI_0169 (tpiA)
  Exosomal proteins of bladder cancer cells
   BCI_0169 (tpiA)
  Exosomal proteins of melanoma cells
   BCI_0169 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ABF13817
UniProt: Q1LTT4
Position
187374..188144
Genome map
AA seq 256 aa AA seqDB search
MRHPLVIGNWKLNGSKHMVSNFIISLRNQLSNMINCCNVAIAPPMIYLDRAKSYLTGSHI
ALGAQNVDLHVSGAFTGEISAKMLKDIGAKYIIIGHIERRLYHKESNEDIANKFACLKNE
GLIPVLCIGETKEENEKDQTKAICVRQLDYILNIVGTQAFKNAVIAYEPIWAIATGKSAN
PLQIQKIHKFIRSYLFNHDQAIAEQVIIQYGGSVNASNAAELFNQPDVDGALVGGASLKA
DIFATIIKAAARAKKN
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccgttagttattggtaactggaaactaaacggtagtaaacatatggttagc
aattttatcatatcactccgtaatcaattaagtaatatgattaactgctgcaacgttgct
atagccccaccaatgatatatttggacagagctaaatcttatttaactggtagccatata
gctctaggagcgcaaaatgttgatctccatgtttctggtgcatttactggtgaaatttcg
gctaagatgcttaaagatattggcgctaaatatattattattggccatattgaacgtcgc
ttataccataaagaaagcaatgaggatatagctaataaatttgcttgcctaaaaaatgaa
ggacttattcctgttttatgtattggagaaactaaagaagagaatgaaaaagatcagact
aaagctatttgcgtccgtcagcttgactatattctcaatatagtaggtactcaagcgttt
aaaaatgcagtcatagcctatgagcctatttgggcaattgctaccggaaaatccgctaat
ccgttacagatacagaaaatacataaatttataagaagctatcttttcaatcatgatcag
gctatagcagagcaggttataattcaatacggaggatcagtaaatgctagtaatgcagct
gagctgtttaaccaaccagatgttgatggcgcattagttggcggtgcatcgctgaaagct
gatatctttgctactatcattaaggcagctgcacgagcaaaaaaaaactaa

DBGET integrated database retrieval system