KEGG   Baumannia cicadellinicola Hc (Homalodisca coagulata): BCI_0171Help
Entry
BCI_0171          CDS       T00349                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bci  Baumannia cicadellinicola Hc (Homalodisca coagulata)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:bci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCI_0171 (pfkA)
   01230 Biosynthesis of amino acids
    BCI_0171 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCI_0171 (pfkA)
   00030 Pentose phosphate pathway
    BCI_0171 (pfkA)
   00051 Fructose and mannose metabolism
    BCI_0171 (pfkA)
   00052 Galactose metabolism
    BCI_0171 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BCI_0171 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BCI_0171 (pfkA)
Enzymes [BR:bci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BCI_0171 (pfkA)
Protein phosphatases and associated proteins [BR:bci01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BCI_0171 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(189206..190168)
Genome map
AA seq 320 aa AA seqDB search
MINKIGVLTSGGDSPGMNAAIRSVVRAGLSEGLEIYGISDGYQGLYQDRMRKLDRYSVSD
IINRGGTFLGSARFQEFREEAIRAIALNNMSKYGLGALVVIGGDGSYMGAKLLTEMGLPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSTSHQRISIVEVMGRYCGDLTMA
AAIAGGCEFIVLPEVEFQPEDLVYEIKASIAQGKKHAIVAITEYICNVFELALYIEKETG
RETRATVLGHIQRGGNPVAYDRILASRMGAYSIELLLQGYRGRCVGVQNERLVHHDIADV
IQNMKRPFRRDFLETARKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaaatcggggtactaactagtggtggtgattctccaggaatgaatgcggct
atccgtagcgtagttagggcagggctttcggaaggcttagagatttacgggatttctgat
ggctaccagggtttatatcaagatcgtatgagaaaactagatcgctacagtgtttccgat
attattaaccgtggaggcacttttcttggttctgcgcgttttcaagagtttcgtgaagag
gctatacgggctattgctcttaataatatgagtaaatatggtttgggtgccctagtggtt
attggcggtgatggatcttatatgggcgcaaaactattaacagaaatgggtttaccatgt
ataggattaccaggtactattgataatgatgtagctggaactgattatactattggttat
tttacggcgttagaaacagtcgttgaagctattgaccgtttacgtgatacttctacatct
catcaacgtatttcaatagtagaagtaatggggcgttattgcggtgatctaacaatggct
gctgccattgctggtggttgcgagtttattgtattacctgaagtagaatttcaaccagaa
gacttagtctacgaaattaaggcgagtatagctcaaggcaaaaaacatgctattgtagca
attaccgagtatatttgtaatgtgtttgaactggcgctatatatcgaaaaagagactggg
cgtgaaacacgcgcaactgttttaggtcatatccagcgtggtggtaacccagtagcctat
gatcgcattctggcatcaagaatgggagcatactcaatcgaactattactacagggatat
agaggacgttgcgttggagtacaaaatgagcggcttgtacatcatgatattgctgatgtt
attcaaaatatgaagcgtccttttcgccgtgattttttggaaactgcacgtaaattattc
taa

DBGET integrated database retrieval system