KEGG   Baumannia cicadellinicola Hc (Homalodisca coagulata): BCI_0258Help
Entry
BCI_0258          CDS       T00349                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bci  Baumannia cicadellinicola Hc (Homalodisca coagulata)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:bci00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BCI_0258 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCI_0258 (pyrB)
Enzymes [BR:bci01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BCI_0258 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
273459..274484
Genome map
AA seq 341 aa AA seqDB search
MINKIKSPSIRGAFYFCLHVTYWNVRRIIKLINPLYRKHIISINDMSSNELELVLNIAAH
LKFKPQPELLKNKVIASCFFEASTRTRLSFETAIHRLGASVVGFSDAHSTSLSKKGETLA
DTISVISTYVDAIIIRHPHEGAARLATEFSGTVPILNAGDGANQHPTQTLLDLFNIYETQ
GKLNNLRIAMVGDLKYGRTVHSLTQALIKFDSNHFYFIAPDTLGMPSYILHTLIDHDIKY
SMHLNLAEVIPELDILYMTRVQKERLDPTEYINVKAQFVLQIHHLLHARANMRILHPLPR
VDEIAYEVDQTPYAYYFQQAGNGVFTRQALLALVLNKYLTE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgattaacaaaataaaaagcccctcaatacgaggggctttttatttttgccttcatgtt
acttactggaatgtaaggaggattataaaattgataaatcccctctatagaaaacatatt
atttctatcaatgatatgagcagcaacgaactagaattagttttaaacatagcagctcat
ctaaaattcaaaccacagccagaattactgaaaaacaaggtaatagctagctgttttttt
gaggcttctacccgtactagattatcgtttgaaacagctattcatcgccttggagcatca
gtagtaggcttttctgatgctcatagtacctctttaagcaaaaaaggcgaaacattagca
gatactatttccgtcattagtacctatgtagatgcaataataatccgccatccacatgaa
ggtgctgcaagattagcaactgagttttccggtacagtacctatccttaacgccggtgat
ggagctaatcaacatccaacgcaaaccttacttgatcttttcaatatttatgaaacccaa
ggtaaattaaacaatcttcgtattgctatggttggtgatttaaaatatggtcgtacggta
cattccctcacgcaagcattgataaaattcgatagtaatcacttttattttattgcacct
gatacgttaggtatgccttcttatattttacatactcttatagatcacgatattaagtat
agtatgcatcttaatctcgcagaagttatacccgagttagatattttatatatgactaga
gtacaaaaagaacgtttagatcctactgaatatattaacgttaaagcacaatttgtacta
cagattcatcatctgctccatgcacgcgcgaacatgcgtattcttcatcctttaccaaga
gttgatgaaatagcctatgaagtagatcaaacgccctatgcgtactattttcaacaagca
ggcaatggtgtgtttactcgccaagctttactcgcactagtattaaataaatatttaact
gaataa

DBGET integrated database retrieval system