KEGG   Baumannia cicadellinicola: BCI_0531Help
Entry
BCI_0531          CDS       T00349                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bci  Baumannia cicadellinicola
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bci00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCI_0531 (dxr)
Enzymes [BR:bci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BCI_0531 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
550015..551211
Genome map
AA seq 398 aa AA seqDB search
MKYLTILGSTGSIGTSTLTVIKQNPDKFTVRALVAKNNFTLMTKQCLDFRPSWVGMVDKR
AARELKANLAQLGIAINIISGNQAACELAALKEIDTVMAAIAGVDGLLSTLSALRAGKRV
LLANKESLVSCGRLFMNEVHQHNAQLLPVDSEHNAIFQILPEPIQRQLGCLSLSKYGVSQ
IILTGSGGPFRQTPLDALATITSDQACIHPNWSMGRKISVDSATMMNKGLEYIEARCLFN
ASTDQIEVLLHPQSIFHSMVRYVDGSVLAQLAYPDMRIPITYALSYPTRVPIKVTPLNFL
QLGTLSFDQPDNKRYPCLQLAIEASKLGQAATTTLNAANEVAVAAFLQRKIRFTDIASVN
QMVLDKINLEEPSSIEEVLCIDRQARINAHLSIRYLAL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatttaactattctaggaagcacaggttctattggaactagcacattaacggta
attaaacaaaaccctgataagtttactgtacgtgcactagtagcaaaaaacaactttact
ttaatgactaagcagtgtttagatttccgtccatcttgggtaggaatggtcgataaaagg
gctgctagggaactaaaagctaacttagctcaactaggaattgctattaatattatttct
ggtaatcaggctgcttgtgaactagctgcactaaaagagattgataccgttatggcagca
attgcaggtgtagatggtttgctatcaactttatcagcattacgtgctggtaaaagagta
ttactagcaaataaagagtcactagttagttgtggtagactatttatgaatgaggtacat
cagcataacgcacagctattaccagtagatagcgaacataatgcaatttttcaaatttta
ccggaacctattcaacgtcaactagggtgtctatcactatctaaatacggtgtttcgcaa
attatcttaactggttctggtggaccatttcgtcaaacaccgctagatgcattagctaca
ataacatcagatcaagcttgcatacatcccaattggtctatgggacgtaagatatcagta
gattcagcgactatgatgaataaaggattagagtatattgaggcacgttgtttatttaat
gcgtctactgaccaaatcgaagtacttttgcacccacaatctatttttcattcaatggta
cgttatgtagatggtagtgtgctagcgcagctagcatatccagatatgcgtattcctatt
acttatgctctatcatatcctactagagttcccataaaagttacacctttaaacttttta
caacttggtacgctcagttttgatcaaccagataataaacgttatccatgtttacaactt
gcgattgaagcaagtaagcttggacaagcagctacaacaacattaaatgcggctaacgaa
gtagcagtagcagctttcttgcaaagaaaaattcgttttactgatattgcctctgtaaac
cagatggtactagataaaattaatttagaagaaccttctagtatagaagaagtattatgt
attgaccgtcaagcacgtataaatgcccacctcagtattcgttatttagcactataa

DBGET integrated database retrieval system