KEGG   Baumannia cicadellinicola Hc (Homalodisca coagulata): BCI_0547Help
Entry
BCI_0547          CDS       T00349                                 

Gene name
recD
Definition
exodeoxyribonuclease V, alpha subunit (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bci  Baumannia cicadellinicola Hc (Homalodisca coagulata)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bci00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCI_0547 (recD)
Enzymes [BR:bci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BCI_0547 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
574456..576315
Genome map
AA seq 619 aa AA seqDB search
MENIILQAQKLGLWRPLDIHFAHLMVALSHSTDALFLASACLSADVGMGHVCLPLSLLTP
DTLFEGLHPKLAQQAWQQAGSLQLNDWQNLLLTSPSVSDGSRSTPLVLDKQQLYLHRLWQ
DECTVAHFFQRSMLVPYDENIVRNILNALFPTTNNSINWQKIAIALALTSKVSLISYRTS
NDKNTMITKLLAAILQINKSEYLHIIIAAPTSKVTAQLTDYIARSMMILTHDYLRYKITY
QVINLYKLLGTQPNSRRIQYYCDNPLYLDILILDESSIVDLPMMANLINALPAQARVIFL
GNDDQFISVDTGTVFSDIFQLIDHGYSIKRCQELSRLTGYQLSNNRTNNMFSYQVTDSLC
LLQNNNSLKDSSGISILANMINTGNNNDALILLNSSKYADIYYIQRHCELDYQRMVHDCV
TNYSNYLQLLNAGESPASIIEEFNRYRLLSMLRKGKFGVVCLNXCIEQTLIYYGLLKKNS
STYAGQPIILLHDIQSLGLYNGDIGLILSESKNNKLHAYFILPNNSIKVVATSYLPKYAT
AFAITVYQSQELKFTHAALVLPDEICSPIFTRELLYAGVTKARKFLSIYAPDNEILADII
THPTQRRSGLTDRLRRMME
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatattatacttcaagcacaaaaactcggtttatggcgacctttagatattcat
tttgctcatcttatggtagcgctatcgcattcaacggatgctttatttctagctagtgct
tgtctaagtgctgatgtcggtatgggacatgtttgtctaccactttcactattaacacca
gataccttatttgaaggtcttcatccaaaacttgcgcaacaagcttggcaacaagctgga
agcctccagctgaacgattggcaaaatttactactaacatcgccatcagtgagcgatggt
tcaagatctacgccattagttctagataaacaacagctttatttacatcgtctatggcaa
gatgaatgtactgttgctcatttttttcaacgatctatgctagttccttatgatgagaat
atagtacgtaatatacttaatgcccttttccctactactaataatagtattaattggcaa
aaaattgctattgcattggcacttacgagcaaagtttcgcttatatcctaccgtactagt
aacgataaaaatacaatgataactaagttactagctgctatattacaaattaataagagt
gaatatttacatatcataatagcagctcctactagtaaagtaactgctcaattaactgat
tatattgctcgatcaatgatgatattaactcatgattatttaagatataagattacatat
caggtcataaacttatataaattgttaggtacgcaacctaacagtaggcgtatacaatat
tattgtgataatccactatatttagatattttaattttagatgaatcatcaatagttgat
cttcctatgatggccaatctaattaatgcgctaccagcgcaagctagagtcatatttctg
ggtaatgatgatcagtttatatcagttgatactggaactgtatttagtgatatttttcaa
ttaatagatcatggttatagtattaaacgctgtcaagaattatccagattaacaggatac
cagttatctaacaaccgcaccaataatatgtttagctatcaagtaacagatagcttgtgt
ttattacaaaacaacaattctttaaaagatagttctggtattagtatattagcaaatatg
attaacaccggtaataacaatgatgctcttatcttgcttaattcaagcaaatatgctgat
atttactatatacagcgacattgtgagttagattaccaacggatggtacatgactgtgtt
acaaattattctaattatttacaactattaaatgccggtgaatcaccggcctctatcata
gaagaatttaaccgttaccggttgctttcaatgctcaggaaagggaaatttggcgtagtt
tgcttaaatyattgcattgaacaaacgctgatatactatggtcttcttaagaagaatagt
agtacttatgctggtcaaccaattatacttctacatgatatacaatcactaggcttatat
aatggggatattgggctcatactctctgagagtaaaaataataaactacatgcatatttt
atattgcctaataacagcataaaagtagtagctactagttatttacctaaatacgcaact
gcgtttgcaattacagtctatcagtcacaggaattaaaatttacccatgctgcactggta
ctaccagatgagatatgctctcctatatttactcgtgagcttttatatgctggagtaaca
aaagcacgtaagtttctttctatttatgctccagataatgaaatactcgctgatattatt
actcatcctactcaacgacgtagtggtctaacagaccggttgcgaagaatgatggagtaa

DBGET integrated database retrieval system