KEGG   Baumannia cicadellinicola: BCI_0561Help
Entry
BCI_0561          CDS       T00349                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bci  Baumannia cicadellinicola
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bci00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bci00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
593307..593804
Genome map
AA seq 165 aa AA seqDB search
MIISLIAAMTVDRIIGIKNTMPWHLYDDLIWFKKHTNNKPVIMGRKTFDAIKKPLSGRLN
IVLSRNFIPSRDQDIIWVDNPIKALIAAGNVTEVMVIGGAQIYNIFILQAHRLYLTHIDI
NIKGDTWFPHYHTNQWRVTFRKYHNDQEKNLPRYYFEILERMTNS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgattattagtttaattgctgcaatgacagtagatcgcatcataggtataaaaaatact
atgccttggcatttatatgatgatttgatctggtttaaaaaacatacaaataataaacca
gtcattatgggccgtaaaacctttgatgctattaagaagcctttatctggtcgattgaat
atcgtattaagccgtaatttcatcccgtctagagaccaagacattatctgggtagataat
cctattaaggcgttgatagcagcaggtaatgttaccgaggtaatggtaattggtggtgct
caaatatataatatttttatcttacaggctcatagactttatctaacccatattgatatt
aatatcaaaggtgatacttggtttccccattatcacactaatcagtggagggttacattt
cgtaaataccataacgatcaagaaaaaaatttaccaagatattacttcgaaattctagaa
agaatgacaaattcttaa

DBGET integrated database retrieval system