KEGG   Baumannia cicadellinicola Hc (Homalodisca coagulata): BCI_0570Help
Entry
BCI_0570          CDS       T00349                                 

Gene name
cysQ
Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bci  Baumannia cicadellinicola Hc (Homalodisca coagulata)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bci00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BCI_0570 (cysQ)
Enzymes [BR:bci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BCI_0570 (cysQ)
Transfer RNA biogenesis [BR:bci03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    BCI_0570 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(599882..600625)
Genome map
AA seq 247 aa AA seqDB search
MINKIIAIARTAGKAIMQVYMGNQPLALNNKPDSSPVTAADLVSHQVIVDHLHQLTPDIP
ILSEENPANWDLRQHWRYFWLVDPLDGTKEFLRRNGEFTVNIALIEHSKPIMGVVYAPAI
DILYAADNMKAWKVDENNSLFELVVTDAKPPIVVVSRSHGNNHELFNYLTQIGEYQIKTI
GSSLKFCMIAEGSAQIYPRFTPTNIWDTAAGHAIAIAAGAKVHDWHQKEIDYLPRKSFLN
PNFKVSF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatcaataaaataattgcaatcgctcgtactgcaggaaaagctattatgcaggtatac
atgggcaatcagccactagcactaaataataagccagattcttctcctgtaacagcggca
gatctagtatcacatcaggtaatagtggatcatttacatcaattaactcctgatataccg
attctctcggaagagaatcctgctaactgggatttacgacagcattggcgctacttttgg
ttagtagatccattagatggaactaaagagtttttgcgtcgtaatggtgagttcacggtt
aacattgctctcattgaacatagcaagccaatcatgggagtagtatatgcacctgctata
gatatattgtatgcagcggataatatgaaagcatggaaagtagatgaaaataactcttta
tttgaactagtagtaacagatgcaaaaccaccgatcgtagtagttagccgttctcatggt
aataatcatgaactatttaattacttaacacaaataggagaatatcagatcaaaactatc
gggtcatctctaaaattttgtatgattgcagaaggtagtgcacagatttatccacgtttt
acaccaactaatatctgggatactgcggcaggtcatgcaattgctatagctgctggagca
aaagtgcatgactggcatcaaaaagaaattgattatttaccacgtaaatcttttcttaat
cctaactttaaagtctcattttaa

DBGET integrated database retrieval system