KEGG   Burkholderia cenocepacia J2315: BCAL0134Help
Entry
BCAL0134          CDS       T00771                                 

Gene name
cheB1
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bcj02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bcj02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:156813..157904
Genome map
AA seq 363 aa AA seqDB search
MTAVQKIKVLCVDDSALIRSLMTEIINSQPDMTVVATAPDPLVARELIKQHNPDVLTLDV
EMPRMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAVDFVTKPRVGIRDGML
DYAEKLADKIRAASRARVRQAPQPQAAARTADSAAAAPMINNPLVSTEKLIIIGASTGGT
EAIREVLTPLPPDAPAVLIAQHMPPGFTKSFAQRLNGLCRIAVKEAEHGERVLPGHAYIA
PGHAHLLLARSGANYIAQLSDEPPVNRHRPSVDVLFRSAATHAGKNAIGVILTGMGRDGA
AGLLEMKRAGAHTFAQDEASCIVFGMPREAIALGGADEIAPLADMSRRVMARLATMGDRV
QRV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagtgcagaagatcaaagtattgtgcgtcgacgattcggcgctgatccgcagc
ctgatgaccgagatcatcaacagccagcccgacatgacggtggtcgcgaccgcgcccgat
ccgctcgtcgcgcgcgagctcatcaagcagcacaaccccgacgtgctcacgctcgacgtc
gaaatgccgcgcatggacgggctcgacttcctcgagaagctgatgcgcctgcggccgatg
ccggtcgtgatggtgtcgtcgctgaccgagcgcggctcggaaatcacgctgcgcgcgctc
gaactcggcgcggtggatttcgtcacgaagccgcgcgtcgggattcgcgacgggatgctc
gactacgcggaaaagctcgccgacaagatccgcgcggcgtcgcgcgcgcgcgtgcgccag
gcgccgcagccgcaggccgccgcgcgcacggcggacagcgccgcggccgcgccgatgatc
aacaacccgctcgtcagtaccgagaagctgatcatcatcggcgcgtcgacgggcggcacc
gaggcgatccgtgaagtgctgacgccgctgccgccggatgcgccggccgtgctgatcgcg
cagcacatgccgccgggcttcacgaaatcgttcgcgcagcgactgaacggcctgtgccgg
atcgcggtgaaggaagccgagcatggcgaacgcgtgctgccgggccatgcgtacatcgcg
ccgggccacgcacacctgttgctcgcgcgaagcggcgcgaactatattgcgcaactgtcg
gacgagccgccggtgaaccggcaccgcccgtcggtcgacgtgctgttccgctcggcggcg
acgcatgcgggcaagaacgcgatcggcgtgatcctcaccgggatgggccgcgacggcgcg
gcgggcctgctggaaatgaaacgcgcgggcgcccacacgttcgcgcaggacgaagcgagc
tgcatcgtgttcgggatgccgcgtgaggcgatcgcgctcggcggcgcggacgagatcgcg
ccgctcgccgacatgagccgccgcgtgatggcgcgcctggcgacgatgggcgaccgcgtg
cagcgcgtgtga

DBGET integrated database retrieval system