KEGG   Burkholderia cenocepacia J2315: BCAL0389Help
Entry
BCAL0389          CDS       T00771                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bcj  Burkholderia cenocepacia J2315
Brite
Enzymes [BR:bcj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BCAL0389 (dsbC)
Secretion system [BR:bcj02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BCAL0389 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:423017..423745
Genome map
AA seq 242 aa AA seqDB search
MKKTIRIASLALAVTMATLGCTAQADQTTDKLKATLQARLGNDAPIKSVSKSPVAGLYEV
NLGSQIIYSDAAGDYVLLGDLVDAKTHKNLTDARLSEINKIDFASLPFANAIKVVKGNGA
RKIAVFSDPNCPYCKKLETTLQSVDNVTVYTFLYPVLSPDSTAKSKAIWCATDRAKTWES
WMLDHRAPSGAGTCDTSALDKNLALGRGMNVTGTPTIFLPDGRRLPGAVSADQLNQALAS
SK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgatccgcatcgcatcgctggcgctggccgtcacgatggcgacgcttggc
tgcaccgcgcaggccgaccagaccaccgacaagctgaaggctacgctgcaggcccggctg
ggcaacgacgcgccgatcaagagcgtgtcgaaatcgccggttgcaggcctttacgaagtg
aacctcggctcgcagatcatctatagcgacgcggcgggcgactacgtgctgctcggcgat
ctcgtcgacgcgaagacgcacaagaacctgaccgacgcccgcctgtccgaaatcaacaag
atcgacttcgcgagcctgccgttcgcgaatgcgatcaaggtcgtcaagggcaacggcgcc
cgcaagatcgcggtgttctccgatccgaactgtccgtactgcaagaagctcgagacgacg
ctgcagtcggtcgacaacgtgaccgtctacacgttcctgtatccggtgctgtcgccggat
tcgaccgcgaagtcgaaggcgatctggtgtgcgaccgaccgcgcgaagacgtgggaaagc
tggatgctcgaccaccgcgcgccgtccggcgccggtacctgcgataccagcgcgctggac
aagaacctcgcgctcggccgcgggatgaacgtcacaggtacgccgacgatcttcctgccg
gacggccgccgcctgccgggcgcggtatcggccgaccagctcaaccaggcgctcgcctcg
agcaagtaa

DBGET integrated database retrieval system