KEGG   Burkholderia cenocepacia J2315: BCAL0409Help
Entry
BCAL0409          CDS       T00771                                 

Gene name
paaF
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BCAL0409 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BCAL0409 (paaF)
   00650 Butanoate metabolism
    BCAL0409 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    BCAL0409 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCAL0409 (paaF)
   00310 Lysine degradation
    BCAL0409 (paaF)
   00360 Phenylalanine metabolism
    BCAL0409 (paaF)
   00380 Tryptophan metabolism
    BCAL0409 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCAL0409 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCAL0409 (paaF)
   00281 Geraniol degradation
    BCAL0409 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCAL0409 (paaF)
   00627 Aminobenzoate degradation
    BCAL0409 (paaF)
   00930 Caprolactam degradation
    BCAL0409 (paaF)
Enzymes [BR:bcj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCAL0409 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:443179..443955
Genome map
AA seq 258 aa AA seqDB search
MAYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALKAFDADDDIGAIVVTGSEKA
FAAGADIGMMATYSYMDVYRGDYITRNWETVREIRKPIIAAVSGFALGGGCELAMMCDII
FAADTAKFGQPEIKLGVMPGAGGTQRLPRAVSKAKAMDMCLTARFMDAVEAERAGLVSRV
LPADKLLDEAIAAATTIAEFSLPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATEDQ
KEGMAAFVEKRKPVFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgagaacatcctggtggagacccgggggcgtgtcggtctggtgacgctgaac
cgtccgaaggcgctgaatgcgctgaacgatgcgctgatggatgagctgggcgccgcgctg
aaggcgttcgatgcggacgacgacatcggcgcgatcgtcgtgaccgggagcgaaaaggcg
ttcgcggccggtgcggacatcggcatgatggcgacctactcctatatggatgtctatcgg
ggcgactacatcacgcgcaactgggagacggtccgcgagatccgcaagccgatcattgcc
gcggtttcgggctttgcgctgggcggtggctgcgagctggcaatgatgtgcgacatcatt
ttcgcggcggacacggccaagttcggtcagccggaaatcaagctgggcgtcatgccgggg
gcgggtggcacgcagcgtttgccgcgcgcggtatcgaaggcgaaggcgatggacatgtgc
ctgaccgcgcgcttcatggacgctgtcgaagcggagcgtgccgggctcgtgtcacgcgtg
ctgcccgccgacaagctgctcgacgaggcgattgccgccgccaccacgatcgccgagttt
tcgttgccggcagtcatgatggtcaaggagtcggtgaaccgcgcgtacgagacgacgctg
gctgaaggcgttcacttcgagcgccggctgttccattcgctgttcgcaaccgaagatcag
aaggaagggatggcggcattcgtcgagaagcggaagccggtcttcaagcaccgctga

DBGET integrated database retrieval system