KEGG   Burkholderia cenocepacia J2315: BCAL0423Help
Entry
BCAL0423          CDS       T00771                                 

Gene name
dnaA
Definition
(GenBank) chromosomal replication initiator protein DnaA
  KO
K02313  
chromosomal replication initiator protein
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCAL0423 (dnaA)
DNA replication proteins [BR:bcj03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    BCAL0423 (dnaA)
Chromosome [BR:bcj03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    BCAL0423 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(467298..468875)
Genome map
AA seq 525 aa AA seqDB search
MNDFWQHCSALLERELTPQQYVTWIKPLAPVAFDASANTLSIAAPNRFKLDWVKSQFSGR
IADLAREFWNTPIEVQFVLDPKAGMRSAPAGAAPAAPRAPLAPNGPAATVAAIAANLTAN
ASAAPAAPADVPMTPSAAAARHLNADDADIDLPSLPAHEAAAGRRTWRPGPGAAPANGGE
ADSMYERSKLNPVLTFDNFVTGKANQLARAAAIQVADNPGISYNPLFLYGGVGLGKTHLI
HAIGNQLLLDKAGARIRYIHAEQYVSDVVKAYQRKAFDDFKRYYHSLDLLLIDDIQFFSG
KSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMR
VAILMRKAQSEGVNLSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHGREISIELTKEA
LKDLLTVQNRQISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSL
PEIGELFGGRDHTTVLHAVRKIADERSKDAQLNHELHVLEQTLKG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatttctggcaacactgttccgcactgctggagcgcgagctgacgccccagcag
tacgtgacgtggatcaaacccttggccccggtggccttcgatgcgtcggcgaacacgctg
tccatcgccgcgccgaaccgcttcaagctggactgggtcaagagccagttttcgggccgg
atcgccgatctggcccgcgaattctggaacacgccgatcgaagtccagttcgtcctcgat
ccgaaggccggcatgcgcagcgcccccgcaggcgccgcaccggccgccccgcgtgcaccg
ctggccccgaacggccccgccgcgacggtcgccgcgatcgccgccaacctgaccgcgaat
gcttccgctgcgcccgccgcgccggccgacgtgccgatgacgccgtcggcggccgccgcg
cgccacctgaacgccgacgacgccgacatcgacctgccgagcctgcccgcgcacgaagcg
gcggccggccgccgcacgtggcgtccgggcccgggcgccgcgcccgcgaacggcggcgaa
gccgattcgatgtacgaacgctcgaagctgaacccggtgctcacgttcgacaacttcgtg
accggtaaagccaaccagctcgcgcgcgcggccgcgatccaggtcgcggacaatcccggc
atctcgtacaacccgctgttcctgtacggcggcgtcggcctcggcaagacccacctgatc
cacgcgatcggcaaccagttgctgctcgacaaggccggcgcgcggatccgctacatccac
gccgagcaatacgtgtcggacgtggtgaaggcgtaccagcgcaaggcgttcgacgacttc
aagcgctactaccactcgctcgacctgctgctgatcgacgatatccagttcttctccggc
aagtcgcgcacgcaagaggaattcttctacgcgttcgaggcgctcgtcgcgaacaaggcg
caggtgatcatcaccagcgacacgtatccgaaggagatttcgggcatcgacgatcgcctg
atctcgcgcttcgattcgggcctgaccgtcgcgatcgagccgcccgagctggaaatgcgc
gtcgcgatcctgatgcgcaaggcgcagtcggaaggcgtgaacctgtcggaagacgtcgcg
ttcttcgtcgcgaagcacctgcgctcgaacgtgcgcgagctcgaaggcgcgctgcgcaag
atcctcgcgtattcgaagttccacggccgcgagatctcgatcgagctgaccaaggaagcg
ctgaaggacctgctgaccgtgcagaaccggcagatttcggtcgagaacatccagaagacc
gtcgccgacttctacaacatcaaggtcgcggacatgtactcgaagaagcgtcccgcgaac
atcgcgcggccgcggcagattgcgatgtacctggcgaaggaactcacgcagaagagcctg
ccggaaatcggcgagctgttcggcgggcgcgatcacaccaccgtgctgcacgcggtgcgc
aagatcgccgacgagcgcagcaaggacgcgcagctcaaccacgagctgcacgtgctggaa
cagacgctgaagggctga

DBGET integrated database retrieval system