KEGG   Burkholderia cenocepacia J2315: BCAL0782Help
Entry
BCAL0782          CDS       T00771                                 

Definition
putative chitobiase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BCAL0782
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BCAL0782
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BCAL0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(853175..855661)
Genome map
AA seq 828 aa AA seqDB search
MKRTLPSLIAGLLIAVLSPAVISAAPASAAAGANAGTAQAAAAQAASLAMLLSNGLALRV
AVDNNHAAAAGVPCADLGADGAACATGRLILQNRGHAAIADGGWKLYLHSIRRLLRIDRP
GFALRRLTGDLYELTPQPGSVRLAPGERIELPFVAEYWLLRYSDVIPRPYVVVDGAPPAV
LRYDDTDNELRYVESLPADAQNNSTGNAPPVAARPDPGRALPSVKRELPLPGTLELRGVE
LALPDLPDAQVAALRERATTLGLDGAGVPVRGFVAPRRLPADLATPGGYRLAIGPRGVLI
EGYDRAGLYYGVQTLYSLAPAGGGPIPAMLVEDAPRFTHRGMHVDLARNFKQPATLRRLI
DQMSAYKLNRLHLHLSDDEGWRIEIPGLPELTEIGGRRCHDPSETRCLLPQLGSGPDNRS
GGGYLTRDDYVALVRYAAARFVQIIPEIDMPAHARAAVVTMEARYRRLHAAGREQEANAY
RLLDPQDTTNLTTVQFYDRRSDLNPCVPGALNFASKVIREIAAMHADAQAPLQTWHYGGD
EAKNIFLGGGFQPLNGTDPNKGRIDLAAQDKPWARSPACTALLQRGEIKSIDELPTRFAK
QVSAAVNANGIGTMAAWQDGIKHANGPQDFSTRHVMVSLWDTIFWGASDSARDLSGKGYQ
TVLALPDYLYFDFPYTLNPRERGYYWGSHATDEYKVFSLAPENLPQNAEVMGDRDGNPFE
VTGTGPAPRIDGMQGQAWGEVMRNDTFLEYMTYPRLLALAERAWHRADWELPYAAGVRFK
RGDTHHVDIATLQRDWAGFATLLTQRELPKLDRAGVGYRKPTFTLTNP
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcgtaccttgccctccctcattgccggcctgctgatcgcggtgctgtcgccggcg
gtgatctccgcggcgccggcgtcggccgccgctggcgcgaacgccggcaccgcgcaagcg
gccgccgcccaggcggccagcctcgcgatgctgctgtcgaacggcctcgcgttgcgcgtg
gccgtcgacaacaaccacgcggccgcggccggcgtaccgtgcgccgatctcggcgccgac
ggcgccgcctgcgcgaccggccgcctgatcctgcagaaccgaggccatgcggcgatcgcc
gacggcggctggaagctctacctgcacagcatccgccgcctgctgcggatcgaccggccg
ggcttcgcgctgcggcggctcaccggcgacctgtacgagctgacgccgcagccgggctcg
gtgcggctcgcgcccggcgagcgcatcgagctgccgttcgtcgccgaatactggctgctg
cgttacagcgacgtgattccgcgtccgtacgtcgtcgtcgacggcgcgccgccggccgtg
ctgcgctacgacgacaccgacaacgagctgcgctacgtcgaatcgctgccggccgacgcg
cagaacaactcgaccggcaacgcgccgcccgtggccgcgcggcccgatcccggtcgcgcg
ctgccgagcgtgaagcgcgagctgccgctgcccggcacgctcgagctgcgcggcgtcgaa
ctcgcgctgccggacctgccggacgcgcaggtcgcggcgctgcgcgagcgcgcgacgacc
ctcggactcgacggcgcaggcgtgccggtacgcggcttcgtcgcgccgcgccggctgccg
gccgacctcgcgacaccgggtggctaccggctcgcgatcgggccgcgcggcgtgctgatc
gaaggctacgatcgcgcgggcctctactacggcgtgcagacgctctactcgctcgcgccg
gccggcggcggcccgatcccggcgatgctcgtcgaggatgcgccgcgcttcacgcatcgc
gggatgcacgtcgacctcgcgcgcaacttcaagcagccggcgacgctgcgccgcctgatc
gaccagatgagcgcgtacaagctcaaccgcctgcacctgcatctgtccgacgacgaaggc
tggcgcatcgagattcccggcctgcccgagctgaccgagatcgggggacgccgctgccac
gacccgagcgagacgcgctgcctgctgccgcagctcggctccgggccggacaatcgctcg
ggcggcggctacctgacgcgcgacgactacgtggcgctcgtgcgctacgcggccgcgcgc
ttcgttcagatcattcccgagatcgacatgcccgcgcatgcgcgggcggccgtcgtgacg
atggaggcgcgctaccggcggctgcatgcggcgggtcgcgagcaggaagcgaacgcatac
cggctgctcgacccgcaggacacgacgaacctgacgacggtgcagttctacgaccggcgc
agcgacctgaacccgtgcgtgccgggcgcgctcaacttcgcgtcgaaggtgatccgcgag
atcgcggcgatgcacgcggacgcgcaggcgccgctgcagacgtggcactacggcggcgac
gaagcgaagaacatcttcctcggcggcggcttccagccgctgaacggcaccgacccgaac
aaggggcgcatcgatctggccgcgcaggacaagccgtgggcgcgttcgcccgcttgcacg
gcgctgctccagcgcggcgagatcaagtcgatcgacgagctgccgacgcgtttcgcgaaa
caggtgagcgcggcggtcaacgcgaacgggatcggcacgatggccgcgtggcaggacggc
atcaagcatgcgaacgggccacaggatttcagcacgcgccacgtgatggtgtcgctgtgg
gacacgatcttctggggcgcgtcggacagcgcgcgcgacctgagcggcaagggctaccag
acggtgctcgcgctgcccgactacctgtacttcgacttcccgtacacgctcaatccgcgc
gagcgcggctactactggggctcgcacgcgaccgacgagtacaaggtgttctcgctcgcg
ccggagaacctgccgcagaacgccgaagtgatgggcgaccgcgacggcaacccgttcgag
gtgacgggcacgggccccgcgccgcgcatcgatggcatgcagggccaggcgtggggcgag
gtgatgcgcaacgacacctttctcgaatacatgacctatccgcgactgctcgcgctcgcc
gagcgcgcgtggcaccgggccgactgggagctgccgtatgcggccggcgtgcgcttcaag
cgcggcgacacgcatcacgtcgacatcgccacgctgcagcgcgactgggccggcttcgcg
acgctgctcacgcaacgcgaattgccgaagctcgaccgcgccggcgtcggctaccggaag
ccgaccttcacgctgacgaatccgtga

DBGET integrated database retrieval system