KEGG   Burkholderia cenocepacia J2315: BCAL0832Help
Entry
BCAL0832          CDS       T00771                                 

Gene name
phaA
Definition
(GenBank) putative poly-beta-hydroxy-butyrate storage protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCAL0832 (phaA)
   00630 Glyoxylate and dicarboxylate metabolism
    BCAL0832 (phaA)
   00640 Propanoate metabolism
    BCAL0832 (phaA)
   00650 Butanoate metabolism
    BCAL0832 (phaA)
  Lipid metabolism
   00071 Fatty acid degradation
    BCAL0832 (phaA)
   00072 Synthesis and degradation of ketone bodies
    BCAL0832 (phaA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCAL0832 (phaA)
   00310 Lysine degradation
    BCAL0832 (phaA)
   00380 Tryptophan metabolism
    BCAL0832 (phaA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCAL0832 (phaA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCAL0832 (phaA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCAL0832 (phaA)
Enzymes [BR:bcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCAL0832 (phaA)
Exosome [BR:bcj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCAL0832 (phaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:903042..904235
Genome map
AA seq 397 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKVAAPELGATVIRAVLERAGVKPEQVSEVIMGQVLTAG
SGQNPARQSLIKAGLPNAVPGMTINKVCGSGLKAVMLAANAIVAGDAEIVIAGGQENMSA
SPHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGITAENVAKEYGITREEQDAFAA
LSQNKAEAAQKAGRFDDEIVPVSIPQRKGEPLQFATDEFVRHGVTAESLAGLKPAFAKDG
SVTAANASGLNDGAAAVLVMSAQKAAALGLTPLARIKAYANAGVDPSVMGMGPVPASRRA
LERAGWTPGDLDLMEINEAFAAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMVKRDAKRGLASLCIGGGMGVALAVERVGAAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtagtgatcgtatcggccgcgcggaccgcggtcggcaaattcggcggctcg
ctggcgaaggttgcggcgcccgaactgggcgcgacggtgatccgcgcagtgctggagcgt
gcgggcgtgaagcccgagcaggtcagcgaagtgatcatgggccaggtgctgacggccggc
tccgggcagaacccggcgcggcagtcgctgatcaaggcggggctgccgaacgccgtgccg
gggatgacgatcaacaaggtgtgcggctcgggcctgaaggccgtgatgctggcggcgaac
gcgatcgtcgcgggcgacgcggagatcgtgatcgcgggtggccaggagaacatgagcgcg
tcgccgcacgtgctgccgggctcgcgcgacgggttccggatgggcgacgcgaagctggtc
gacacgatgatcgtcgacgggctgtgggacgtgtacaaccagtaccacatggggatcacg
gcggagaacgtcgcgaaggaatacgggatcacgcgcgaagagcaggacgcgttcgcggcg
ctgtcgcagaacaaggcggaagccgcgcagaaggccgggcgcttcgacgacgagatcgtg
ccggtgtcgattccgcaacgcaagggcgagccgctgcagttcgcgacggacgagttcgtg
cgtcacggcgtgacggcggagtcgctggcggggctgaagccggcgttcgcgaaggacggc
tcggtgacggcggcgaacgcgtcggggctgaacgatggagcggcggcggtgctggtgatg
tcggcgcagaaggcagccgccttgggcctgacgccgctggcgcggatcaaggcgtatgcg
aacgcgggcgtggacccgagcgtgatgggcatgggcccggtgccggcgtcgcgccgtgcg
ctggagcgcgcgggctggacgccgggcgacctggacctgatggagatcaacgaggcgttc
gcggcgcaggcgctggcggtgcacaagcagatgggctgggacacgtcgaaggtgaacgtg
aacggcggggcgatcgcgatcggccacccgatcggtgcgtcgggctgccggatcctggtg
acgctgctgcacgagatggtcaagcgcgatgcgaagcgcgggctggcgtcgctgtgcatc
ggcggcgggatgggcgtcgcgctcgcggtcgagcgcgtcggagcagcggcctga

DBGET integrated database retrieval system