KEGG   Burkholderia cenocepacia J2315: BCAL1098Help
Entry
BCAL1098          CDS       T00771                                 

Definition
putative exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCAL1098
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BCAL1098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1201962..1204271
Genome map
AA seq 769 aa AA seqDB search
MTASDDMLEFTGGLVARLPEPADFGIALAEGFARRIGDLARRAGAPSASARWAARAAFAT
SRATAGGHVCVALAALAQRYEAPLDEVRAALAASGVVAFGTLARGDERPLIVDRHDHLYL
SRYFDYERRLADALVAQAGVAAPDEGLSPDRLRDSLARYFGPATGEVDWQRVAAIVALTG
RVTIVSGGPGTGKTTTVVGVLACLLDAHPGLRIALAAPTGKAAQRMQEALHARAGDLPPE
LAARLPDTSYTLHRLLGGGGAAGFRHHRDNPLPYDLIVVDEASMIDVALAAHLLDALAPG
ARLVLLGDKDQLAAVEAGAVFAELSARPAFTATARTRIAQALGVDEAAFVAALPVPDEAA
PAAVPVANPVPAAARAPAPPSASVPVSRRSASRSKVDTRQASLFDDEPQDDEVSSTDIAP
PPPTESATLLDASASDDTPAWIEADELAWLDAVELPPFDAGDAALASVTAASPSAGEAAA
AAASAIAPAAAPLADCVVWLERNYRFGLDSPIGRLSLAIRRGDVQAALDALPADDSAAAS
FHDDAGDTLASSTVERLARRFGAYLDALRDALAAPVPDPLPLFDALNRFRILCATRSGSR
GAEHVNALVAAHVRHAARVPLAVGAHWFTGRPIMVTRNDYALGLFNGDIGIALPDAHGVL
RVWFRRADGTARAVSPAALPPHETAFALTVHKSQGSEFDEAALVLPASFGRVLTRELVYT
AVTRARTRVQVIGPRRVLAQAVATRTQRDSGLAARVDEALARRRTEASR
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatccgacgacatgctcgaatttaccggcggcctcgtcgcgcggttgcccgag
ccggccgatttcggcatcgcgctcgcggaaggcttcgcgcgccgcatcggcgatctcgcg
cggcgtgccggtgcgccgtccgcatcggcacgctgggcggcgcgcgccgcgttcgcgacg
agccgcgcgaccgccggtggccacgtgtgcgtcgcgcttgctgcgctcgcgcagcgttac
gaagcgccgctcgacgaggtccgcgcggcgcttgccgcgagcggcgtggtcgcgttcggc
acgctggcacgcggcgacgaacggccgctgatcgtcgaccggcacgatcatctgtacctg
tcgcgctatttcgattacgaacggcggctcgccgatgcgctcgtcgcgcaggcgggcgtc
gccgcgccggacgaaggcctgtcgcccgaccggttgcgcgacagtctcgcccgttacttc
gggccggctaccggcgaagtcgactggcagcgcgtcgcggcgatcgtcgcgctgaccggc
cgcgtgacgatcgtcagcggcgggccgggcacgggcaagacgacgaccgtcgtcggcgtg
ctcgcctgtctgctcgacgcgcatccggggctgcgcatcgcgctggccgcaccgaccggc
aaggccgcgcagcggatgcaggaggcgctgcacgcgcgtgccggcgatctgccgcccgag
ctcgcggcgcgcctgcccgacacgtcgtacacgctgcatcggttgctgggcggcggcggg
gcggccggcttccggcatcatcgcgacaatccgttgccgtacgacctgatcgtcgtcgac
gaggcgtcgatgatcgacgtcgcgctcgccgcacatctgctcgacgcgctcgcgccgggt
gcgcggctcgtattgctgggcgacaaggatcaactggccgcggtcgaggccggcgccgta
ttcgcggagctgagcgcgcggccggcgttcaccgccacggcgcgcacgcgcatcgcgcag
gcgctgggcgtcgacgaggcggcgttcgtcgccgcgttgccggtgccggacgaagcggcg
ccggcagcggttcccgttgcgaatccggtgcccgctgccgcacgggcaccggcgccgcca
tcggcatccgttcctgtttcgcgcagatcggcgtctcggtcgaaagtcgatacgcggcag
gcatcgctgttcgacgacgaaccgcaggacgatgaagtgtcgtcgaccgacatcgcgccg
ccgccacccaccgagtcggcaacgctcctcgatgccagcgcatcggacgatacgcccgcc
tggatcgaggccgacgaactcgcgtggctcgacgccgtcgagctgccgccgttcgatgcg
ggcgacgcggcgctcgcatcggtgactgctgcatcgccgtcggcaggcgaagccgccgcg
gctgccgcgtccgccatcgcgcccgctgcggcgccgctcgccgactgcgtcgtgtggctc
gaacgcaattaccgcttcgggctcgattcgccgatcggacggctgtcgctcgcgatccgc
cgcggcgacgtgcaggcggcgctcgatgcgctgcccgccgacgattcggcggccgcatcg
tttcacgacgatgcgggcgacacgctggcgtcgtcgacggtcgagcggctcgcccggcgc
ttcggcgcatacctcgacgcattgcgcgacgcgctggccgcaccggtgcccgatccgttg
ccgctgttcgacgcgctcaaccggttccggatcctgtgcgcgacccgcagcggttcacgc
ggcgcggagcacgtcaatgcgctggtggccgcgcacgtcaggcatgcggcgcgcgtgccg
ctcgcggtcggtgcgcactggttcaccgggcggccgatcatggtcacgcgcaacgactat
gcgctcgggctgttcaacggcgacatcggcattgcattgcccgacgcacacggtgtgctg
cgcgtgtggttccggcgcgcggacggcaccgcgcgcgcggtgtcgccggccgcgctgccg
ccgcacgaaacggcgttcgcgctgacggtgcacaagtcgcagggctcggaattcgacgaa
gcggcgctcgtgttgcccgcgtcgttcggccgggtgctcacgcgcgagctggtctatacg
gccgtcacgcgcgcccgcacgcgcgtgcaggtaatcgggccgcggcgcgtgctggcgcag
gcggtcgcgacgcgcacgcagcgcgattcggggctcgcggcccgcgtcgacgaggcgctc
gcccggcgccgcacggaggcttcgcgatga

DBGET integrated database retrieval system