KEGG   Burkholderia cenocepacia J2315: BCAL1218Help
Entry
BCAL1218          CDS       T00771                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BCAL1218 (speB)
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BCAL1218 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1328487..1329455
Genome map
AA seq 322 aa AA seqDB search
MSQNDFAFTRDSLYGTQAEPSFAGATSFMRRRFSRDLDGVDLAITGVPFDSAASHRPGTR
FGPRGLRIASTGIAWERPWPWSFDPFDVLAAVDYGDCAFDLGQPEAVPGAIERHADAILA
RGCAMLTLGGDHFITYPLLKAHAKVHGPLSLVHFDAHTDTWPDRDVKRIDHGTMFYHAAR
EGWVVPERSAQIGIRTTNDDPMGFDIQDARHVHGSTPAAVAARIRERVGDHPVYLTFDID
CLDPAFAPGTGTPVSGGLSSHQAFEILRHLDGINLVGMDVVEVSPPYDHAEITSLAGATI
ALELICLYASRRRQKKEASIDG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaacgatttcgcgttcacgcgcgacagcctctacggcacccaggccgaaccc
agtttcgcgggcgcgacgagcttcatgcgccggcgtttcagccgtgatctcgacggcgtc
gacctcgcgatcaccggcgtgccgttcgattcggccgcctcgcaccggcccggcacgcgg
ttcggcccgcgcgggttgcggatcgcgtcgacgggcatcgcgtgggagcgcccgtggccg
tggtcgttcgatccgttcgacgtgctggccgcggtcgactacggcgattgcgcgttcgat
ctcgggcagcccgaagcggtgccgggcgcgatcgagcggcatgccgatgcgatcctcgcg
cgcggctgcgcgatgctgacgctcggcggcgatcacttcatcacgtatccgctgctcaag
gcgcatgcgaaggtgcacgggccgctgtcgctcgtgcatttcgacgcacataccgacacg
tggcccgaccgcgacgtgaagcgcatcgatcacgggacgatgttctatcacgcggcgcgg
gaagggtgggtcgtgcccgaacgatccgcccagatcggcattcgcacgaccaacgacgat
ccgatgggcttcgacatccaggatgcgcgccacgtgcatgggtcgacgcccgccgcggtc
gccgcgcgcattcgcgagcgcgtcggcgatcacccggtgtacctgacgttcgatatcgac
tgtctcgatccggcgttcgcgccgggcaccgggacgccggtctcgggcggcctgtcgagc
catcaggcgttcgagatcctgcgccacctcgacggcatcaacctggtcggcatggacgtg
gtcgaagtgtcgccgccgtacgatcatgcggaaatcacgtcgctggccggtgcgacgatc
gcgctggaactgatctgcctgtatgcgtcgcgccggcggcagaaaaaggaagcgtcgatc
gatggatga

DBGET integrated database retrieval system