KEGG   Burkholderia cenocepacia J2315: BCAL1268Help
Entry
BCAL1268          CDS       T00771                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcj00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1:1379314..1380192
Genome map
AA seq 292 aa AA seqDB search
MSPFLPAPLQCGRFELTFERPLVMGILNATPDSFSDGGRFLARDDALRRAERMIAEGADL
LDIGGESTRPGAPPVPLDEELARVIPLVEALRPLNVPLSIDTYKPAVMRAALAAGADLIN
DIWGFRQPGAIDAVRDGNSGLCAMHMLGEPQTMQVGEPDYGDVVTDVRDFLAARAQALRD
AGVAAERICVDPGFGFGKAVVDDNYALLAALPDTAPARPDGRAYPILAGMSRKSMLGAVI
GGKPPLERVAASVAAALCAVERGAAIVRVHDVAATVDALSVWNAVRAAARQR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgtccccgttccttcccgcgccgctccagtgcggccgcttcgaactgacgttcgaacgc
ccgctcgtgatgggcatcctcaacgccacgcccgattcgttctccgacggcggccgcttc
ctcgcgcgcgacgatgcgctgcgccgggccgagcggatgattgccgaaggcgccgacctg
ctcgatatcggcggcgaatcgacgcgccccggtgcgccgcccgtgccgctcgacgaagag
ctcgcgcgcgtgatcccgctcgtggaggcgctgcggccgctgaacgtgccgctgtcgatc
gatacctacaagccggccgtgatgcgcgcggcgctggccgccggcgcggacctgatcaac
gacatctgggggttccgccaaccgggcgcgatcgacgcggtgcgcgacggcaacagcggc
ctgtgcgcgatgcacatgctcggcgagccgcagacgatgcaggttggcgagcccgactac
ggcgacgtcgtgaccgacgtgcgcgattttctcgccgcgcgcgcgcaggcgttgcgcgac
gccggcgtggcggcggagcgcatctgcgtcgatcccggcttcgggttcggcaaggcggtc
gtcgacgacaactatgcgctgctggccgcgttgccggacacggcgcccgcgcggcccgac
gggcgcgcttatccgattctcgcgggcatgtcgcgcaagtcgatgctcggcgcggtgatc
ggcggcaagccgccgctcgagcgcgtcgcggcgagcgtggcggccgcgttgtgcgctgtc
gagcgtggcgccgcgatcgtgcgcgtgcacgatgtcgcggcgacggtcgatgcactcagc
gtctggaacgccgtgcgcgcagccgcgcggcaacgataa

DBGET integrated database retrieval system