KEGG   Burkholderia cenocepacia J2315: BCAL1287Help
Entry
BCAL1287          CDS       T00771                                 

Definition
(GenBank) putative acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00010  Glycolysis / Gluconeogenesis
bcj00620  Pyruvate metabolism
bcj00640  Propanoate metabolism
bcj00680  Methane metabolism
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
bcj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAL1287
   00620 Pyruvate metabolism
    BCAL1287
   00640 Propanoate metabolism
    BCAL1287
  Energy metabolism
   00680 Methane metabolism
    BCAL1287
Enzymes [BR:bcj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCAL1287
Lipid biosynthesis proteins [BR:bcj01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCAL1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAR51587
UniProt: B4E5H2
Position
1:complement(1397611..1399230)
Genome map
AA seq 539 aa AA seqDB search
MLPAADRYDHLLARFRWDLPARYNIGVDVCDKWADGSGRLALIHETAQGDVSRLTFDDLR
NASNRLANSFARAGLRRGDRIGIFLAQGPETAIAHLAAYKFGAIAVPLFTLFGVDALEYR
LANSEAAALVTDAAGYAKIAPLRAQLPALHTAYCIGGDAPDVPGVLRYDAALAAEAPDFV
PVDTAADDPAVIIYTSGTTGKPKGALHAHRVLLGHLPGVEMSQQCFPRDARLFWTPADWA
WIGGLLDVLLPSWHHGVPVLARRFEKFDGDAAFALMARHGVTHAFLPPTALKLMRAVTAP
RERYALSLKSVASGGESLGTELTAWGRDALGVTINEFYGQTECNMVLSSCAALFDAQPGA
IGKAVPGHAVAIVDADGTPLPPGVEGRIAVRRPDPVMFLEYWRNPDATRDKFAGDYLLTG
DTGTIDADGFVRFVGRDDDVITSAGYRIGPGPIEDCLLTHPAVRMAAVVGVPDATRTEIV
KAFVVLNPGHVGDAALVSTLQAHVRTRLAAHEYPRAIAFVDSLPMTATGKIVRRALRDA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccgccgccgaccgctacgatcacctcctcgcccgcttccggtgggaccttccg
gcgcgctacaacatcggcgtggacgtgtgcgacaaatgggccgacggcagcggacgcctc
gcgctgatccacgaaacggcgcaaggcgacgtttcgcgcctcacgttcgacgacctgagg
aatgcttctaaccggctcgcgaacagcttcgcgcgtgccggcctgcggcgcggcgaccgg
atcggcatctttctcgcgcaagggcccgaaacggccatcgcgcacctcgccgcgtacaaa
ttcggcgcgatcgcggtaccgctcttcacgctgttcggcgtcgacgcgctcgagtaccgg
ctcgcgaacagcgaggcggccgcgctcgtcaccgacgcggccggctacgcgaaaatcgcg
ccgctgcgcgcgcaactgccggcgctgcataccgcctactgcatcggcggcgatgcgccc
gacgtgcccggcgtgttgcgctacgacgcggcgctcgccgccgaagcgccggatttcgtg
ccggtggatacggccgccgacgatccggccgtgatcatctacacgtccggcacgaccggc
aagccgaagggcgcgctgcatgcgcatcgcgtgctgctcggccacctgcccggcgtcgag
atgtcgcagcagtgcttcccgcgcgacgcgcgcctgttctggacgcccgccgactgggca
tggatcggcgggctgctcgacgtgctgctgccgtcatggcatcacggcgtgccggtgctc
gcgcgccgcttcgagaaattcgacggcgacgcggcattcgcgctgatggcgcggcacggc
gtcacccacgcgttcctgccgcccaccgcgctgaagctgatgcgcgcggtcacggcgcca
cgcgaacgttacgcgctgtcgctgaaatcggtcgcgagcggcggcgaatcgctgggcacc
gaactgacggcgtggggccgcgacgcgctcggcgtgacgatcaacgagttctacgggcaa
accgagtgcaacatggtgctgtcgtcatgcgcggcgctgttcgatgcgcagcccggcgcg
atcggcaaggcggtgcccggtcatgcggtcgcgatcgtcgatgcggacggcacgccgctg
ccgcccggcgtcgaaggccgcatcgcggtacgccgccccgacccggtgatgtttctcgaa
tactggcgcaaccccgacgcgacgcgcgacaagttcgcgggcgactacctgctcaccggc
gatacgggcacgatcgacgccgacggcttcgtgcgcttcgtcggccgcgacgacgacgtg
atcacaagcgccggttaccggatcggccccggcccgatcgaggactgcctgctcacgcat
ccggcggtgcggatggcggccgtcgtcggcgtgcccgacgcgacgcgtaccgagatcgtc
aaggcattcgtcgtgctgaaccccggccacgtcggcgacgcagcgctcgtcagcacactg
caggcccacgtgcgcacgcggctcgccgcgcacgagtatccgcgcgcgatcgcgttcgtc
gacagcctgccgatgaccgcgaccggcaagatcgtgcggcgcgcgctgcgcgacgcgtga

DBGET integrated database retrieval system