KEGG   Burkholderia cenocepacia J2315: BCAL1390Help
Entry
BCAL1390          CDS       T00771                                 

Gene name
bcsZ
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bcj00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1530264..1531415
Genome map
AA seq 383 aa AA seqDB search
MTCAAAGMATRAHAAGTGAADAAGAGCSVAWPRWDAFKRDFISADGRVIDVGSADSRTVS
EGQAYGLFFALVANDRRMFDTILAWTENNLAQGDLSAHLPAWLWGRAPDGAWRVLDANPA
SDADLWIAYALVEAGRLWRERSYTARGALLAKRVLDAETATVPGLGLTLLPGPTGFKLAD
GQWRVNPSYSPPQVIRALGARLPDDRRWAALASSTGRVLLDTAPKGFSPDWALYRAGKGF
GPDPDTHAQSAYNAIRVYLWAGMLDRADPLAAPLLAKFAPFADAIAAHGAPPERVDTTTG
VAGPNDGNGGFSAAAVPFLDARGQHALADAQAARVDTLARQSAPGYYTSVLTLFGLGWRD
GRYRFGADGTLDTRWGDRSCAAR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtgcgcggcggccggcatggccacgcgcgcgcacgccgccgggactggcgcggcc
gacgcggccggcgccggatgcagcgtggcgtggccgcgctgggacgcgttcaagcgcgat
ttcatctcggccgacggccgcgtgatcgacgtcggctcggccgattcgcgcacggtatcg
gaggggcaggcgtatggactgttcttcgcgctggtcgcgaacgaccggcgcatgttcgac
acgatcctcgcatggaccgagaacaacctcgcgcagggcgacctgagcgcgcacctgcct
gcgtggctgtggggccgcgcgcccgacggcgcgtggcgcgtgctcgacgcgaaccctgcg
tcggacgccgacctgtggatcgcgtatgcactcgtcgaggccggacggctgtggcgcgag
cgcagctatacggcccgcggcgcgctgctcgcgaagcgcgtgctcgacgccgagacggcg
accgtgccgggcctcggcctcacgctgctgccggggccgaccgggttcaagctggccgac
ggccaatggcgcgtgaacccgagctattcgccgccgcaggtgattcgcgcgctcggcgcg
cggctgcccgacgaccgtcgctgggccgcgctggcgtccagtaccgggcgcgtgctgctc
gacaccgcgccgaaggggttctcgccggactgggcgctgtatcgcgcgggcaagggtttc
gggcccgatccggacacgcatgcgcagagcgcgtacaacgcgatccgcgtgtacctgtgg
gccggcatgctcgaccgtgccgatccgctcgccgcgccgctgctcgcgaagttcgcgccg
ttcgccgatgccatcgccgcgcacggcgcgccgcccgagcgggtcgatacgacgacgggc
gtcgcggggccgaacgacggcaacggcggcttctccgcggcggccgtgccgtttctcgac
gcgcgcggccagcacgcgctcgcggatgcacaggcggcccgcgtcgatacgctcgcgcgc
cagtcggcgcccggctactacaccagcgtgctgacgctgttcggcctcggttggcgcgac
ggccgctaccggttcggggcggacggcacgctcgacacccgctggggagaccgttcgtgc
gccgcccgctga

DBGET integrated database retrieval system