KEGG   Burkholderia cenocepacia J2315: BCAL1410Help
Entry
BCAL1410          CDS       T00771                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bcj  Burkholderia cenocepacia J2315
Brite
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BCAL1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1555499..1556875
Genome map
AA seq 458 aa AA seqDB search
MPTATRTTTMHTFLKSFAFARSLVPAAATLAVAGALAALAGCDAQPGTTASAASVVPAAQ
AAPAAPAVAPARQPQTRAQVFEGVKQMTALGKQLFFDPSLSGSGKLACASCHSAEHAFGP
PNALSVQLGGDDMHRTGFRAVPSLKYLRGIPPFSEHFHDSPDEGDESVDAGPTGGLTWDG
RVDTRDAQARIPLLSPFEMSSSPARVAKAVRAAPYADAFRKAFGDQVLGDDRATFDAVLR
ALDAFQQQPALFDPYTSKYDAYLAGHAQLTPAELHGLQLFNDEKKGNCASCHISQRTLEG
GPPQFSDFGLIAIAVPRNRALPVNRDPRFYDLGACGPERTDLKGRDEFCGLFRTPSLRNV
ALRKTFFHNGVYHSLEDVMRFYVERDIHPEKFYPVVHGKVQIYDDLPKRYWPNINREAPF
DRKRGDQPALNAAEIKDVIAFLGTLTDGYQQTAVAAKP
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
ttgcccaccgctaccagaacaacgacgatgcacacctttctgaaatccttcgcgttcgcg
cggtcgctggtccccgccgcggcgacgctcgcggtggctggcgcgctcgccgcgctcgcc
ggttgcgacgcgcagcccggcacgaccgcgtcggccgcgtccgtcgtcccggcggcgcag
gctgctccggccgccccggcggtcgcgccggctcgccagccgcagacgcgcgcgcaggtg
ttcgagggcgtgaagcagatgacggcgctcggcaagcagctgttcttcgatccgtcgctg
tccgggtccggcaagctcgcttgcgcgtcgtgccatagcgccgagcatgcgttcgggccg
ccgaacgcgctgtcggtgcagttgggcggcgacgacatgcaccgtaccggctttcgcgcg
gtgccgtcgctgaagtacctgcgcggcatcccgccgttcagcgagcacttccacgattcg
ccggacgaaggcgacgaaagcgtcgacgcgggtccgaccggtgggctgacctgggacggc
cgcgtcgatacgcgcgatgcgcaggcgcgcattccgctcctgtcgccgttcgagatgagc
agctcgcctgcgcgggtcgcgaaggcggtccgcgccgcgccgtatgccgacgcgttccgc
aaggcgttcggcgaccaggtgctcggcgacgaccgggcgacgttcgatgcggtgctgcgc
gcgctcgatgcattccagcagcagccggcgctgttcgatccgtacacgagcaaatacgac
gcatatctggccggccacgcgcagctcacacccgccgagttgcacgggctgcagctgttc
aacgacgagaagaagggcaattgcgcgagctgccacatcagccagcgcacgctcgaaggc
ggcccgccgcagttcagcgatttcgggctgatcgcgatcgcggtgccgcgcaaccgcgcg
ctgccggtcaatcgcgacccgcgcttttacgatctcggcgcctgcggtcccgaacgcacc
gacctgaaggggcgcgacgaattctgcgggctgttccgcacgccgtcgctgcgcaacgtc
gcgctgcgcaagacgttcttccacaacggcgtgtatcactcgctcgaggacgtgatgcgc
ttctacgtcgaacgcgacatccatccggagaagttctacccggtcgtgcacggcaaggtg
cagatctacgacgacctgccgaagcgctactggccgaacatcaaccgcgaagcgccgttc
gaccgcaagcgcggcgaccagccggcgctgaatgcggccgagatcaaggacgtgatcgcg
ttcctgggcacgctgactgacggatatcagcaaacggccgtcgccgccaagccctag

DBGET integrated database retrieval system