KEGG   Burkholderia cenocepacia J2315: BCAL1447Help
Entry
BCAL1447          CDS       T00771                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCAL1447 (galU)
   00052 Galactose metabolism
    BCAL1447 (galU)
   00500 Starch and sucrose metabolism
    BCAL1447 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BCAL1447 (galU)
Enzymes [BR:bcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCAL1447 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1598154..1599038)
Genome map
AA seq 294 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLELVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVADNPFAVILADDLLDGNPPVMKQMVDVFDHYHSSVIGVEEIPPSETKSYGIVDGKEWE
ESIVKMSAIVEKPAPEVAPSNLGVVGRYILKPRIFEHLRALKPGAGGELQLTDAIQALLA
DEQVLAYKYQGTRYDCGSKLGYLKATVEFALRHPEVGAEFETYLRTRDGAQPTV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggcggtattccccgttgccggtctcggcacgcggttcctcccg
gcaacgaaggcgagcccgaaggagatgctgccggtcgtcgacaagccgctgatccagtat
gcggtcgaggaagcgatcgcggcgggcatcaccgagatgatcttcgtcaccgggcgcagc
aagcgcgcgatcgaggatcacttcgacaagtcgtacgagatcgaggccgaactcgaggcg
cgcggcaaggaaaagctgctcgagctggtgcgcagcatcaagccgagccacgtcgactgc
ttctacgtgcgccagccggaggcgctcggcctcggccacgcggtgctgtgcgcggaaaag
ctggttgccgacaacccgttcgcggtgatcctcgcggacgacctgctcgacggcaacccg
ccggtgatgaagcagatggtcgacgtgttcgaccactatcacagctcggtgatcggcgtc
gaagagatcccgccgtcggagacgaagtcgtacggcatcgtcgacggcaaggaatgggaa
gagtcgatcgtcaagatgtcggcgatcgtcgagaagccggcgccggaagtcgcgccgtcg
aacctcggcgtggtcggccgctacatcctgaagccgcggattttcgagcacctgcgcgcg
ctaaagccgggcgcgggcggcgagctgcagctcaccgacgcgatccaggcgctgctcgcc
gacgaacaggtgctggcctacaagtatcagggcacgcgctacgactgcggcagcaagctc
ggctacctgaaggcgacggtcgaattcgcgctgcgccacccggaagtcggtgcggagttc
gagacgtacctgcgcacgcgcgacggcgctcaaccgaccgtctga

DBGET integrated database retrieval system