KEGG   Burkholderia cenocepacia J2315: BCAL1516Help
Entry
BCAL1516          CDS       T00771                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAL1516 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCAL1516 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BCAL1516 (sucB)
Enzymes [BR:bcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BCAL1516 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1679581..1680858
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAPAAQPAAATASSSAA
ASPAAAKLLAEKGLSTGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPSLPE
VKVPASAATWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctgtcggagtcggtgtcggaagccaccatg
ctgcagtggaagaagaagccgggcgaagcagtcgcgcaggatgaaatcctgatcgaactc
gagaccgacaaggtcgtcctcgaagtgccggcaccggcagcgggcgtgctcgcgcaagtg
ctgcagaacgacggcgacacggtcgtggccgaccagatcatcgcgacgatcgacaccgaa
gcgaaggcaggtgctgccgaagcagcggcaggcgccgccgaagtcaagccggccgccgcg
ccggctgccgccgcaccggccgctcagccggcagccgcaaccgcatcgagctcggccgcc
gcatcgccggccgcagcgaagctgctggccgagaagggcctgtcgacgggcgacgtcgca
ggttcgggccgcgacggccgcgtcacgaagggcgacgcgctggctgcaggcagcgcaccg
aaggctgctccggccgccgcaccggcgaagaccgccgctgcgaagccgtcgctgccggaa
gtgaaggtgccggcgtcggccgcgacgtggctgaacgatcgtccggaacagcgcgtgccg
atgtcgcgtctgcgtgcgcgtatcgccgagcgtctgctcgaatcgcagcagaccaacgcg
atcctgacgacgttcaacgaagtgaacatggctccggtcatggaactgcgcaacaagtac
aaggacaagttcgagaaggaacatggcgtgaagctcggcttcatgtcgttcttcgtgaag
gccgccgtccatgcgctgaagaaattcccgctcgtgaacgcgtcgatcgacggtaacgac
atcgtctatcacggctacttcgacatcggtatcgcggtcggttcgccgcgcggcctggtc
gtgccgatcctgcgcaacgcggatcaactgagcctcgccgagatcgagaagaagatcgcc
gaattcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggtacg
ttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaacccg
ccgcagtcggccatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaacggc
cagatcgtgatccgcccgatcaactacctcgcgctgtcgtacgaccaccgcatcatcgac
ggccgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctggaagatccggcacgc
ctgctgctcgacctgtaa

DBGET integrated database retrieval system