KEGG   Burkholderia cenocepacia J2315: BCAL1516Help
Entry
BCAL1516          CDS       T00771                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00020  Citrate cycle (TCA cycle)
bcj00310  Lysine degradation
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
bcj01200  Carbon metabolism
Module
bcj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCAL1516 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BCAL1516 (sucB)
Enzymes [BR:bcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BCAL1516 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CAR51815
UniProt: B4E7M0
Position
1:1679581..1680858
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAPAAQPAAATASSSAA
ASPAAAKLLAEKGLSTGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPSLPE
VKVPASAATWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctgtcggagtcggtgtcggaagccaccatg
ctgcagtggaagaagaagccgggcgaagcagtcgcgcaggatgaaatcctgatcgaactc
gagaccgacaaggtcgtcctcgaagtgccggcaccggcagcgggcgtgctcgcgcaagtg
ctgcagaacgacggcgacacggtcgtggccgaccagatcatcgcgacgatcgacaccgaa
gcgaaggcaggtgctgccgaagcagcggcaggcgccgccgaagtcaagccggccgccgcg
ccggctgccgccgcaccggccgctcagccggcagccgcaaccgcatcgagctcggccgcc
gcatcgccggccgcagcgaagctgctggccgagaagggcctgtcgacgggcgacgtcgca
ggttcgggccgcgacggccgcgtcacgaagggcgacgcgctggctgcaggcagcgcaccg
aaggctgctccggccgccgcaccggcgaagaccgccgctgcgaagccgtcgctgccggaa
gtgaaggtgccggcgtcggccgcgacgtggctgaacgatcgtccggaacagcgcgtgccg
atgtcgcgtctgcgtgcgcgtatcgccgagcgtctgctcgaatcgcagcagaccaacgcg
atcctgacgacgttcaacgaagtgaacatggctccggtcatggaactgcgcaacaagtac
aaggacaagttcgagaaggaacatggcgtgaagctcggcttcatgtcgttcttcgtgaag
gccgccgtccatgcgctgaagaaattcccgctcgtgaacgcgtcgatcgacggtaacgac
atcgtctatcacggctacttcgacatcggtatcgcggtcggttcgccgcgcggcctggtc
gtgccgatcctgcgcaacgcggatcaactgagcctcgccgagatcgagaagaagatcgcc
gaattcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggtacg
ttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaacccg
ccgcagtcggccatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaacggc
cagatcgtgatccgcccgatcaactacctcgcgctgtcgtacgaccaccgcatcatcgac
ggccgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctggaagatccggcacgc
ctgctgctcgacctgtaa

DBGET integrated database retrieval system