KEGG   Burkholderia cenocepacia J2315: BCAL1661Help
Entry
BCAL1661          CDS       T00771                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BCAL1661
Enzymes [BR:bcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BCAL1661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1813369..1814298
Genome map
AA seq 309 aa AA seqDB search
MTANAPGAGRVTVVGSLNMDLVVRAPRLPLPGETLAGHAFAQAAGGKGGNQAVAAARLGA
QVTMIGCVGADAHGAALRAGLEAEGIDCIGLATSVSASTGVALIVVDDASQNAIVIVAGG
NGEVTTDTITRHEAALAAADVLICQLETPPDAVFAALSAGRRLGRTVVLNPAPAVAPLPE
GWLPLVDYLIPNEVEAAALTGLPVRDPAEAEAAARALQAGGARNVLVTLGARGVLALTAD
GAARHYPAPVVQAVDTTAAGDTFIGGFSARLAAGADVDAAIRFAQRAAALSVTRAGAQPS
IPTRAELAD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgaacgcaccgggcgccggccgcgtgacggtggtcggcagcctcaacatggat
ctcgtcgtgcgggcgccgcggctgccgctgccgggcgaaacgctcgccgggcatgcgttc
gcgcaggcggcgggcggcaagggcggcaaccaggccgtcgccgcggcccggctgggcgcg
caggtcacgatgatcggctgcgtcggcgcggatgcgcacggcgcggcactgcgcgcgggc
ctggaggccgagggaatcgactgcatcgggctcgcgaccagcgtgtcggcgtcgaccggc
gtcgcgctgatcgtcgtcgacgacgcgagccagaacgcgatcgtgatcgtcgcgggcggc
aacggcgaggtcacgaccgacacgatcacgcggcacgaagccgcgctggcggcggccgac
gtgctgatctgccagctcgagacgccgccggacgcggtgttcgcggcactgtcggccggg
cgccggctcggccgcacggtggtgctcaatccggctccggccgtcgcgccgttgccggag
ggctggctgccgctcgtcgactacctgatcccgaacgaggtcgaggcggccgcgctgacc
gggctgccggtgcgcgatccggcggaggccgaggccgccgcgcgggcgctgcaagccggc
ggcgcgcgcaacgtgctggtcacgctcggcgcgcgcggcgtgctcgcgctgacggccgac
ggcgccgcgcggcattatccggcgccggtcgtgcaggccgtcgacacgacggcggccggc
gacaccttcatcggcggcttttccgcgcggctcgcggccggcgcggacgtcgacgcggcc
atccgcttcgcgcaacgcgcggcggcgctgtcggtcacgcgcgcgggcgcgcagccgtca
attccgacccgcgccgaactggccgactag

DBGET integrated database retrieval system