KEGG   Burkholderia cenocepacia J2315: BCAL1712Help
Entry
BCAL1712          CDS       T00771                                 

Definition
putative magnesium chelatase protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCAL1712
Enzymes [BR:bcj01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BCAL1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1890215..1891300
Genome map
AA seq 361 aa AA seqDB search
MTDPTTPRARAVFPFAALVAQDALQQALLLAAIDPSLGGVLVSGPRGTAKSTAARGLAEL
LPEGQFVTLPLSASDEQVTGTLDLAHALAENGVRFRPGLLARAHLGVLYVDEVNLLADGL
VDTLLDVAASGVNIVERDGVSHAHDARFVLVGTMNPEEGELRPQLLDRFGLMVELENCFD
AAQRERIVKARLAFDLDPDAFRARHAAAQRALADRIHAARGRLPALDFDDAVHARVSALC
IDAAVDGLRADLVMLRAARALAALEQADAVTVSHVARVAEAVLRHRRHAGPPSSQQSSQH
DDERDDRSPPNPRQRPDDRPGETGDTKGDASASQGDWGYLPPEPAGLRDVKSVVPLPLKK
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatccgacgacgccccgcgcccgcgcggtttttccgtttgcggcgctcgtcgcg
caggacgcgttgcagcaggcgctgctgctggccgcgatcgacccgtcgctcggcggcgtg
ctcgtcagcggcccgcgtggcaccgcgaaatcgacggccgcgcgcggcctcgccgagttg
ctgccggaagggcagttcgtcacgctgccgctgtcggcgagcgacgagcaggtgacgggc
acgctcgacctcgcgcatgcgctggccgaaaacggcgtgcgcttccggcccggcctgctg
gcgcgcgcgcatctcggcgtgctgtacgtcgacgaagtgaacctgctcgccgacgggctc
gtcgatacgctgctcgacgtcgccgcgagcggcgtgaacatcgtcgagcgcgatggcgtg
tcgcacgcgcacgatgcgcgtttcgtgctggtcggcacgatgaatcccgaggagggcgag
ctgcgcccgcagttgctcgaccgcttcgggctgatggtcgagctcgagaactgcttcgac
gccgcccagcgcgagcggatcgtgaaggcgcggcttgcgttcgatctcgatccggatgcg
tttcgcgcgcgtcatgcggcggcccagcgggcgctcgcggaccggattcatgcggcgcgc
gggcggctgccggcgctggatttcgacgatgcggtccatgcgcgcgtcagcgcgctgtgc
atcgacgcggccgtcgacgggttgcgggccgatctcgtgatgctgcgcgccgcgcgcgcg
ctggccgcgctggagcaggccgacgcggtgacggtgtcgcatgtggcgcgcgtggccgaa
gccgtgctgcggcaccggcgccatgcggggccgccgtcgtcgcagcagtcgtcgcagcac
gatgacgaacgcgacgatcgttcgccgccgaacccgcgccagcggcccgacgaccggccg
ggcgagaccggcgacacgaaaggcgatgcgtccgcatcgcagggcgactggggctacctg
ccgcccgaaccggccgggctgcgcgacgtgaaaagcgtggtgccgctgccgctaaaaaaa
cgctga

DBGET integrated database retrieval system