KEGG   Burkholderia cenocepacia J2315: BCAL1992Help
Entry
BCAL1992          CDS       T00771                                 

Definition
putative acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BCAL1992
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BCAL1992
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BCAL1992
Lipid biosynthesis proteins [BR:bcj01004]
 Fatty acid synthase
  Component type
   BCAL1992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2195521..2196189
Genome map
AA seq 222 aa AA seqDB search
MDTTFRWKRRAAAAALLGTLLAVTVPARAATASASSQPVIVVLGDSLSAEYGLPRDTGWV
ALLRQRLTTERIDYSVANASVSGDTTSGGRARLPAVLQRLKPSIVVVELGSNDALRGVPL
ATTEQNLRDIIASAQRARAKVVLVGMYVPPNYGPDYTQKFHAVYTRLSKDLAVPLVPFLL
AGIENKPEMFQADQMHPAQQAQGILLDNVWPALKPLLGKPHG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggacacgacatttcgctggaaaagacgcgcggcggccgccgcgctgctgggcaccctg
ctggccgtcaccgtacctgcgcgcgccgcgacggcgtcggcatcgagccagcccgtgatc
gtcgtgctcggcgacagtctctcggccgaatacggactgccgcgcgacacaggctgggtt
gcactgctgcggcaacggctcacgaccgagcgaatcgattatagcgtcgcgaacgccagc
gtcagcggcgacaccacgagcggcggccgtgcacggttgcccgcggtgctgcagcgactc
aagccgtcgatcgtcgtcgtcgaactcggttcgaacgatgcgctgcgcggcgtgccgctc
gcgacgaccgagcagaacctgcgcgacatcatcgccagtgcgcagcgtgcgcgggcgaag
gtcgtgctggtcggcatgtacgtgccgcccaattacggccccgactacacgcagaagttc
cacgcggtctatacgcggctgtcgaaggacctcgccgtgccgctcgtaccgttcctgctg
gccggtatcgagaacaagccggagatgttccaggccgaccagatgcatcccgcgcagcaa
gcccagggcattctgctcgacaacgtgtggccggcgctgaaaccgttgctcggcaagccg
cacggatga

DBGET integrated database retrieval system