KEGG   Burkholderia cenocepacia J2315: BCAL1992Help
Entry
BCAL1992          CDS       T00771                                 

Definition
putative acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bcj01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2195521..2196189
Genome map
AA seq 222 aa AA seqDB search
MDTTFRWKRRAAAAALLGTLLAVTVPARAATASASSQPVIVVLGDSLSAEYGLPRDTGWV
ALLRQRLTTERIDYSVANASVSGDTTSGGRARLPAVLQRLKPSIVVVELGSNDALRGVPL
ATTEQNLRDIIASAQRARAKVVLVGMYVPPNYGPDYTQKFHAVYTRLSKDLAVPLVPFLL
AGIENKPEMFQADQMHPAQQAQGILLDNVWPALKPLLGKPHG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggacacgacatttcgctggaaaagacgcgcggcggccgccgcgctgctgggcaccctg
ctggccgtcaccgtacctgcgcgcgccgcgacggcgtcggcatcgagccagcccgtgatc
gtcgtgctcggcgacagtctctcggccgaatacggactgccgcgcgacacaggctgggtt
gcactgctgcggcaacggctcacgaccgagcgaatcgattatagcgtcgcgaacgccagc
gtcagcggcgacaccacgagcggcggccgtgcacggttgcccgcggtgctgcagcgactc
aagccgtcgatcgtcgtcgtcgaactcggttcgaacgatgcgctgcgcggcgtgccgctc
gcgacgaccgagcagaacctgcgcgacatcatcgccagtgcgcagcgtgcgcgggcgaag
gtcgtgctggtcggcatgtacgtgccgcccaattacggccccgactacacgcagaagttc
cacgcggtctatacgcggctgtcgaaggacctcgccgtgccgctcgtaccgttcctgctg
gccggtatcgagaacaagccggagatgttccaggccgaccagatgcatcccgcgcagcaa
gcccagggcattctgctcgacaacgtgtggccggcgctgaaaccgttgctcggcaagccg
cacggatga

DBGET integrated database retrieval system