KEGG   Burkholderia cenocepacia J2315: BCAL2106Help
Entry
BCAL2106          CDS       T00771                                 

Gene name
gpo
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00480  Glutathione metabolism
bcj00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BCAL2106 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BCAL2106 (gpo)
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BCAL2106 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CAR52406
UniProt: B4ECP6
Position
1:complement(2320647..2321126)
Genome map
AA seq 159 aa AA seqDB search
MSTLYSFSAETLAGAPVSLDAYRGKVLLIVNTASECGFTPQYAGLQKLYDLYAARGFFVL
GFPCNQFGKQEPGDAAQIGAFCERNYGVTFPMFAKIDVKGDHAHPLYRYLTDAAPGILGL
KAIKWNFTKFLIDREGRIVKRYAPSTKPDEIAADIDKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccctgtattcgttcagcgcagagacgctcgccggtgcgccggtatcgctcgac
gcgtatcgcggcaaggtgctgctgatcgtcaataccgcgagcgagtgcggtttcacgccg
cagtacgcgggtctgcagaagctgtacgacctgtacgcggcgcgcggtttcttcgtgctc
ggctttccgtgcaaccagttcggcaagcaggagccgggggacgccgcgcagatcggcgcg
ttctgcgaacgcaactacggcgtcacgtttccgatgttcgcgaagatcgacgtgaagggc
gaccatgcgcatccgctgtatcgttatctgaccgacgcggcgcccggcattctcggcctc
aaggcgatcaagtggaatttcacgaaattcctgatcgaccgcgaagggcggatcgtcaag
cgctacgcgccgtccaccaagcccgacgaaatcgccgcggacatcgacaagctgctgtga

DBGET integrated database retrieval system