KEGG   Burkholderia cenocepacia J2315: BCAL2118Help
Entry
BCAL2118          CDS       T00771                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAL2118 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BCAL2118 (aceA)
Enzymes [BR:bcj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BCAL2118 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2334626..2335933
Genome map
AA seq 435 aa AA seqDB search
MSRQQQAQELQQQWETDPRWKGIKRGYLAEDVVRLRGSIPIEHTLAKRGAEKLWNLINNE
PFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKR
INNTLTRADQIQWSEGKNPGDEGYVDFFAPIVADAEAGFGGVLNAFELMKAMIEAGASGV
HFEDQLASVKKCGHMGGKVLVPTREAVAKLSAARLAADVMGTPTVLVARTDAEAADLITS
DVDDNDKPFLTGERTVEGFFRTKPGLEQAISRGLAYAPYADLIWCETGKPDLEYAKKFAE
AIHKQFPGKLLSYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMF
NLAHSYARTQMSAFVELQQAEFAAADKGFTAVKHQREVGTGYFDAVTQTVEREASTTALH
GSTEDEQFFDGKKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtcagcaacaggcacaggaactgcagcagcaatgggaaaccgatccgcgctgg
aagggcatcaagcgcggctacttggccgaggacgtggtccgcctgcgcggctcgatcccg
atcgagcacacgctggccaagcgcggcgcggaaaaactgtggaacctcatcaacaacgag
ccgttcgtcaacgcactcggcgcgctgaccggcaaccaggcgatgcagcaggtcaaggcc
ggcctgaaggccatctacctgtccggctggcaagtcgccggcgacgcgaacgtcgcgggc
gaaatgtacccggaccagtcgctgtacccggcgaactcggtgccgctcgtcgtcaagcgc
atcaacaacacgctcacgcgcgccgaccagatccagtggtcggaaggcaagaatccgggc
gacgaaggctacgtcgatttcttcgcgccgatcgtcgccgatgcggaagccggtttcggc
ggcgtgctcaacgcgttcgaactgatgaaggcgatgatcgaggccggtgcgtcgggcgtt
cacttcgaggaccagctcgcgtcggtgaagaagtgcggccacatgggcggcaaggtgctc
gtgccgacgcgcgaagccgtcgcgaagctgtcggccgcgcgtctcgcggctgacgtgatg
ggtacgccaaccgtgctggtggcccgcaccgacgcggaagccgccgacctgatcacgtcc
gacgtcgacgacaacgacaagccgttcctgaccggcgagcgcacggtcgaaggcttcttc
cgcacgaagccgggcctcgaacaggcgatctcgcgcggcctcgcgtacgcaccgtacgcc
gacctgatctggtgcgaaaccggcaagccggatctcgagtacgcgaagaagttcgcggaa
gcgatccacaagcagttcccgggcaagctgctgtcgtacaactgctcgccgtcgttcaac
tggaagaagaacctcgacgacgcgacgatcgcgaagttccagaaggagctcggcgcgatg
ggctacaagttccagttcatcacgctggccggcttccatgcgctgaactactcgatgttc
aacctcgcgcacagctatgcccgcacgcagatgagcgcattcgtcgaactgcagcaggcc
gagttcgcggccgccgacaagggcttcacggccgtcaagcaccagcgcgaggtcggcacg
ggctacttcgacgcggtcacgcagacggtcgaacgcgaagcgtcgacgaccgcgctgcac
gggtcgaccgaggacgaacagttcttcgacggcaagaaggtcgcgtaa

DBGET integrated database retrieval system