KEGG   Burkholderia cenocepacia J2315: BCAL2208Help
Entry
BCAL2208          CDS       T00771                                 

Gene name
pdhB
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00010  Glycolysis / Gluconeogenesis
bcj00020  Citrate cycle (TCA cycle)
bcj00620  Pyruvate metabolism
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
bcj01200  Carbon metabolism
Module
bcj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAL2208 (pdhB)
   00020 Citrate cycle (TCA cycle)
    BCAL2208 (pdhB)
   00620 Pyruvate metabolism
    BCAL2208 (pdhB)
Enzymes [BR:bcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCAL2208 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 RnfC_N HlyD_D23 NQRA DUF4813 DEC-1_N HlyD_3 CAT
Motif
Other DBs
NCBI-ProteinID: CAR52509
UniProt: B4EDT7
Position
1:complement(2436248..2437891)
Genome map
AA seq 547 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEIGVKVGDTVEPEQSLVTLESDKATMDVPSPVGGVVKEI
KVKVGDSVSEGSLIVLLEGGAGAQANGAAAPAAAPAPAAAPAAAAPAAAPAASGGTLEVK
VPDIGDYKDVPVIEIGVKVGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKVGDSV
SEGTLIVLLEAAGAPAAAPQASAPAPAAAAPAPAAAPAPAPAKAAPAPAAAAPAAAPSGE
YRASHASPSVRKFARELGVDVARVQGSGPKGRITKEDVTGFVKGVMTGQRAAPGAAAAPA
GGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITELEA
LRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYFHVGFAADTP
NGLVVPVIRDADKKGLVDIAKEMSDLSKAAREGKLKPDQMQGGCFSISSLGGIGGTNFTP
IINAPEVAILGLSRGQMKPVWDGKQFVPRLMLPLSLSYDHRVIDGAEAARFNAYLGALLG
DFRRIIL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtgaaggtgccggatatcggcgattacaaggacgtgccggtc
atcgagatcggcgtgaaggtgggcgatacggtcgagcccgagcagtcgctcgtcacgctc
gagtcggacaaggcgacgatggacgtgccgagcccggtcggcggcgtcgtgaaggaaatc
aaggtcaaggtcggcgattccgtgtcggaaggctcgctgatcgtcctgctcgaaggcggc
gcaggcgcccaggcgaacggcgcggccgcgccggcagcagcgccggctcccgcagcggcg
ccggccgctgctgcgcccgctgccgccccggcagcatccggcggcacgctcgaagtgaag
gtgcccgacatcggcgactacaaggacgttccggtgatcgagatcggcgtgaaggtcggc
gacacggtcgagaaggaacagtcgctcgtcacgctcgaatcggacaaggcgacgatggac
gtgccgagcccggccgccggcgtcgtgaaggacatcaaggtcaaggtgggcgattcggtg
tcggaaggcacgctgatcgtgctgctcgaagccgccggcgcaccggctgccgcaccgcag
gccagcgcaccggctccggccgctgccgcgcccgcgcctgccgctgcaccggcgcccgcg
cctgcgaaggctgcgccggcaccggcagccgccgccccggccgccgcgccgtcgggcgaa
taccgcgccagccacgcatcgccgtcggtccgcaagttcgcacgcgaactcggcgtcgac
gtcgcacgcgtgcagggttcgggtccgaagggccgcattacgaaggaagacgtcacgggc
ttcgtgaagggcgtgatgacgggccagcgtgcggcgccgggcgcggcagccgcgccggca
ggcggcggcgagctgaacctgctgccgtggccgaaggtcgacttctcgaagttcggcccg
ttcgaggcgaagccgctgtcgcgcatcaagaagatctcgggcgcgaacctgcatcgcaac
tgggtgatgatcccgcacgtcacgaacaacgacgaagcggacatcaccgagctcgaggcg
ctgcgcgtccagctgaacaaggagcacgaaaaggcgggcgtgaagttcacgatgctcgcg
ttcgtgatcaaggcagtcgtcgccgcgctgaagaaattcccgaccttcaacgcgagcctc
gacggcgacaacctcgtgttcaagcagtacttccacgtcggtttcgcggccgatacgccg
aacggcctcgtcgtgccggtgatccgcgatgcggacaagaagggcctcgtcgacatcgcg
aaggaaatgagcgacctgtcgaaggccgcgcgcgaaggcaagctgaagccggaccagatg
cagggcggctgcttctcgatctcgtcgctcggcgggatcggcgggacgaacttcacgccg
atcatcaacgcgccggaagtggcgatcctcgggttgtcgcgcggccagatgaagccggtg
tgggacggcaagcagttcgtgccgcgtctcatgctgccgctgtcgctgtcgtatgaccat
cgcgtgatcgatggcgcggaagccgcgcggttcaatgcgtatctcggcgcgttgctcggc
gatttccgtcgcatcattctttga

DBGET integrated database retrieval system