KEGG   Burkholderia cenocepacia J2315: BCAL2304Help
Entry
BCAL2304          CDS       T00771                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BCAL2304
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BCAL2304
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BCAL2304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2555957..2556745)
Genome map
AA seq 262 aa AA seqDB search
MAADLSGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNQDGANAVADEINKAGGKAIG
VAMDVTNEEAVNTGIDKVAEAFGSVDILVSNAGIQIVNPIENYSFADWKKMQAIHVDGAF
LTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNV
RSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVIKKVMLGNTVDGVFTTVQDVAQTVLFL
SAFPSAALTGQSVVVSHGWFMQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagatctgagcggcaagaccgcagtcgtcacgggcgccgcgagcggcatcggc
aaggaaatcgcactggagctcgccaaggcaggcgcggccgtcgcgatcgccgacctgaac
caggacggcgcgaacgcggtcgccgacgagatcaacaaggcaggcggcaaggcgatcggc
gtcgcgatggacgtgaccaacgaggaagccgtaaacaccggcatcgacaaggtggccgaa
gcgttcggctcggtcgacatcctcgtgtcgaatgcgggcatccagatcgtcaacccgatc
gagaactactcgttcgccgactggaagaagatgcaggcgatccacgtggacggcgcgttc
ctgacgacgaaggccgcgctcaagcacatgtacaaggacgatcgcggcggcgtcgtgatc
tacatgggttcggtgcactcgcacgaagcgtcgccgctgaagtcggcgtacgtgacggcc
aagcacggtctgctcggcctggcgcgcgtgctggcgaaggaaggcgcgaagcacaatgtg
cgctcgcacgtcgtgtgtccgggcttcgtgcgcacgccgctggtcgacaagcagattccg
gagcaggcgaaggagctcggcatcagcgaagaggaagtgatcaagaaggtgatgctcggc
aacacggtcgacggcgtgttcacgacggtgcaggacgtcgcgcagacggtgctgttcctg
tcggcgtttccgagcgccgcgctcacgggccagtcggtggtcgtcagccacggctggttc
atgcagtaa

DBGET integrated database retrieval system