KEGG   Burkholderia cenocepacia J2315: BCAL2346Help
Entry
BCAL2346          CDS       T00771                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00010  Glycolysis / Gluconeogenesis
bcj00051  Fructose and mannose metabolism
bcj00562  Inositol phosphate metabolism
bcj00710  Carbon fixation in photosynthetic organisms
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
bcj01200  Carbon metabolism
bcj01230  Biosynthesis of amino acids
Module
bcj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcj_M00002  Glycolysis, core module involving three-carbon compounds
bcj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAL2346 (tpiA)
   00051 Fructose and mannose metabolism
    BCAL2346 (tpiA)
   00562 Inositol phosphate metabolism
    BCAL2346 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BCAL2346 (tpiA)
Enzymes [BR:bcj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BCAL2346 (tpiA)
Exosome [BR:bcj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BCAL2346 (tpiA)
  Exosomal proteins of bladder cancer cells
   BCAL2346 (tpiA)
  Exosomal proteins of melanoma cells
   BCAL2346 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAR52647
UniProt: B4E5M4
Position
1:complement(2598289..2599044)
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGAGAVAAETSIGVCVPFPYLAQVQAQLGG
GRVAFGAQDVSAHEQGAFTGEVAAAMVAEFGARYAIVGHSERRAYHGESSETVAAKTQRA
LAAGLTPVVCVGETLDERESGATEQVVGAQLDAVLAVLTADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRTRLAAKGAADVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
EDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgaacaaagcgagtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgctgctgaacgaagtggtgcagggtgcgggcgcggtggcggctgaaacg
tcgattggcgtgtgcgtgccgttcccgtatctcgcgcaggttcaggcgcaactcggcggt
ggccgtgtcgcgttcggtgcgcaggacgtgtccgcgcacgagcaaggcgcgttcaccggc
gaagtggcggccgcgatggtggcggagttcggcgcgcggtacgcgatcgtcggccattcg
gagcgtcgcgcgtatcacggcgaaagcagcgagacggtcgcggcgaagacgcagcgcgcg
ctcgcggcgggcctcacgccggtcgtgtgcgtcggcgagacgctcgacgagcgcgagtcg
ggtgcgaccgagcaggtcgtcggtgcgcagctcgacgcggtgctggccgtgctgacggct
gacgaggccgcgcgcatcgtcgtcgcgtacgagccggtctgggcgatcggcacgggcaag
agcgcgacgtcggcgcaggcgcaggacgtgcacgcgttcctgcgtacgcgtcttgcggca
aagggtgcggcggacgtgtccgtgctgtacggcggcagcgtgaagccggacaacgcggaa
gagctgttcgcgcagccggacatcgacggcggcctgatcggcggcgcgtcgctgaaggcg
gaagatttcctggcgatctgccgggccgcgcgttga

DBGET integrated database retrieval system