KEGG   Burkholderia cenocepacia J2315: BCAL2346Help
Entry
BCAL2346          CDS       T00771                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAL2346 (tpiA)
   01230 Biosynthesis of amino acids
    BCAL2346 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAL2346 (tpiA)
   00051 Fructose and mannose metabolism
    BCAL2346 (tpiA)
   00562 Inositol phosphate metabolism
    BCAL2346 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BCAL2346 (tpiA)
Enzymes [BR:bcj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BCAL2346 (tpiA)
Exosome [BR:bcj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BCAL2346 (tpiA)
  Exosomal proteins of bladder cancer cells
   BCAL2346 (tpiA)
  Exosomal proteins of melanoma cells
   BCAL2346 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2598289..2599044)
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGAGAVAAETSIGVCVPFPYLAQVQAQLGG
GRVAFGAQDVSAHEQGAFTGEVAAAMVAEFGARYAIVGHSERRAYHGESSETVAAKTQRA
LAAGLTPVVCVGETLDERESGATEQVVGAQLDAVLAVLTADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRTRLAAKGAADVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
EDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgaacaaagcgagtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgctgctgaacgaagtggtgcagggtgcgggcgcggtggcggctgaaacg
tcgattggcgtgtgcgtgccgttcccgtatctcgcgcaggttcaggcgcaactcggcggt
ggccgtgtcgcgttcggtgcgcaggacgtgtccgcgcacgagcaaggcgcgttcaccggc
gaagtggcggccgcgatggtggcggagttcggcgcgcggtacgcgatcgtcggccattcg
gagcgtcgcgcgtatcacggcgaaagcagcgagacggtcgcggcgaagacgcagcgcgcg
ctcgcggcgggcctcacgccggtcgtgtgcgtcggcgagacgctcgacgagcgcgagtcg
ggtgcgaccgagcaggtcgtcggtgcgcagctcgacgcggtgctggccgtgctgacggct
gacgaggccgcgcgcatcgtcgtcgcgtacgagccggtctgggcgatcggcacgggcaag
agcgcgacgtcggcgcaggcgcaggacgtgcacgcgttcctgcgtacgcgtcttgcggca
aagggtgcggcggacgtgtccgtgctgtacggcggcagcgtgaagccggacaacgcggaa
gagctgttcgcgcagccggacatcgacggcggcctgatcggcggcgcgtcgctgaaggcg
gaagatttcctggcgatctgccgggccgcgcgttga

DBGET integrated database retrieval system