KEGG   Burkholderia cenocepacia J2315: BCAL2629Help
Entry
BCAL2629          CDS       T00771                                 

Definition
bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bcj00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2889944..2891914)
Genome map
AA seq 656 aa AA seqDB search
MAGGARAFTAVLTRPDGQSDALAAQLADAGCDVLEFPLIDIAPVDDPAPLDAAFAALADY
ALVIFVSPNAIDRALARYGAIWPNALPVGVVGPGSVAALERHGIAAPAHRVIAPQAPADG
GVPHYDSESLFASIEAAFGGAPALAGKRVLIVRGDGGREWLAERLREAGADVTLVAAYRR
VVPEPRVGAWERVHALLDGQPHAWLVTSSEGVRNLHELARAHLNDAEIDALKHAPLVTPH
PRIEQSARALGFDRITLTGAGDERIVRAFRTMADEAVQPATAAPVTKRMTDTNDSKSVAS
QPAAASAPPTSPPYLAPEPPARRGGSAVLWFVVVVLGCAAGVGGYALNRKIDRLDGTFVA
RQKALDAQTAETRMKTEQALASTHQVDTQLAQLDGKLADAQSAQQALQQQYQDLSRNRDA
WMLEEVDQMLSSASQQLQLTGNTQLALIALQNADARLATSQSAQAVTVRKALAQDIEKLK
AAPAADLTGLAIKLDDAIAKIDALPLSGEAIVPHAAPKAAPADAASSVAAGEPRWKVWWH
DFSAGLGQQLKGLVQVRRIDNADAMLASPDQGYFVRENVKLRLLTARLSLLARNDSAMKA
DLHAAQASLGKYFDQASKDTQTVEDLLKQVDGASLTVAVPNLNTSLNAVQQFKSRG
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcggcgcgcgcgcgttcaccgctgtcctgacgcgtccggacggccagtccgac
gcgcttgcggcgcaactggccgatgccggttgcgacgtgctcgaattcccgctgatcgac
atcgcgccggtcgacgatccggcgccgctcgacgccgcgttcgcggcgctggccgactac
gcgctggtgatcttcgtgtcgccgaacgcgatcgaccgcgcgctcgcgcggtacggcgcg
atctggccgaatgcgctgccggtcggcgtggtcgggcccggcagcgtcgcggcgctcgag
cgtcacggcatcgcggcgcccgcgcatcgcgtgatcgcgccgcaggcgccggccgacggc
ggcgtgcctcattacgattcggaaagcctgttcgcgagcatcgaggccgcgttcggcggc
gcgccggcgctggcgggcaagcgcgtgctgatcgtgcgcggcgacggcgggcgcgaatgg
ctcgccgagcggctgcgcgaggccggggccgacgtcacgctcgtcgccgcgtaccggcgc
gtcgtgccggagccgcgtgtcggcgcgtgggagcgcgtgcacgcgctgctcgacggccag
ccgcacgcgtggctcgtcacgagctcggaaggcgtgcgcaacctgcacgagctcgcgcgg
gcccacctgaacgatgccgagatcgacgcattgaagcatgcgccgctcgtgacgccgcac
ccgcggatcgagcagtccgcgcgcgcattgggttttgataggattacgctgaccggcgcg
ggcgatgagcgcatcgtccgcgcgtttcgaacgatggccgacgaggccgtccaaccggcg
acagccgcaccggtgactaaacgcatgacagataccaacgattccaaaagcgtcgcttcc
cagccggccgctgcatccgcaccgccgaccagccccccttatctcgcgcccgagccgccc
gcacgccgcggcggcagcgcggtgctgtggttcgtcgtcgtcgtgctcggctgcgcggca
ggggtcggcggctacgcgctgaaccgcaagatcgaccggctcgacggtacgttcgtcgcg
cgccagaaggcgctcgacgcgcagacggccgaaacgcggatgaagaccgagcaggcgctc
gccagcacgcaccaggtcgacacgcagctcgcgcagctcgacggcaagctggccgatgcg
cagagcgcgcagcaggcgctgcagcagcaataccaggacctgtcgcgcaaccgcgatgcg
tggatgctcgaggaagtcgaccagatgctgtcgagcgcgagccagcagcttcagctgacc
ggcaacacgcagctcgcgctgatcgcgctgcagaacgctgacgcgcgtctcgcgacgtcg
cagagcgcgcaggccgtcacggtgcgcaaggcgctcgcgcaggacatcgagaagctgaag
gccgcgccggcagccgatctcacgggcctcgcgatcaagctcgacgacgcgatcgcgaag
atcgacgcgctgccgctgtcgggcgaggcgatcgtgccgcacgcggcgccgaaggccgcg
ccggccgacgccgcgtcgtcggtcgccgccggcgagccgcgctggaaggtgtggtggcac
gacttctcggccggcctcggccagcaactgaaggggctcgtgcaggtacgccggatcgac
aacgcggacgcgatgctcgcgtcgcccgaccagggctacttcgtgcgcgagaacgtgaag
ctgcgcctgctcaccgcacggctgtcgctgctggcgcgcaacgacagcgcgatgaaggcc
gacctgcacgccgcacaggcatcgctcggcaagtatttcgatcaggcatcgaaggacacg
cagaccgtcgaggatctgctcaagcaggttgacggcgcgtcgctgacggtcgcggtgccg
aacctgaacacgagcctgaacgccgttcagcagttcaagagccgggggtaa

DBGET integrated database retrieval system