KEGG   Burkholderia cenocepacia J2315: BCAL2719Help
Entry
BCAL2719          CDS       T00771                                 

Definition
putative transmembrane fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BCAL2719
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BCAL2719
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BCAL2719
Lipid biosynthesis proteins [BR:bcj01004]
 Desaturase
  First
   BCAL2719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2983773..2984969)
Genome map
AA seq 398 aa AA seqDB search
MLNSLLDFLSHGLLHFSWWQVALFALAVTHVTIIGVTVYLHRCQAHRALELHPIASHFFR
LWLWMTTGMLTGQWAAIHRKHHAKCETEEDPHSPQTRGIWKVFLEGAELYRAEAKNEETM
RKFSHGTPNDWIERNLYSKYPILGVSLMMVIDVALFGVLGLTVWAVQMVWIPFWAAGVVN
GFGHFWGYRNFNSADASTNLFPWGIVIGGEELHNNHHTFATSAKLSNKWYEFDIGWMYIR
IMSAFGLAKVKKVAPTPRLNKPKTVLDQETLQAVLSNRYEVMASYGKAVKRAYRQELAHL
KELGSSEKYQLMRGARKWFHKDADGLDEPQKKLLPEIFANSQKLHTYFQLRQDLAAIWDR
STASREQLLAQLQDWCHRAEQSGIKALQEFATRLRRYA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaattccctgctcgattttctttcccacgggctcctgcatttttcgtggtggcag
gtcgcgctgttcgcgctcgccgtcacgcacgtcacgatcatcggtgtgacggtctacctg
catcgctgccaggcgcaccgcgcgctggagctgcatccgatcgcgagccacttcttccgt
ctctggctgtggatgaccaccggcatgctgaccggccagtgggccgcgattcaccgcaag
caccatgcgaagtgcgagaccgaggaagatccgcacagcccgcagacgcgcggcatctgg
aaggtgttcctcgagggcgccgagctgtatcgcgcggaagcgaagaacgaagagacgatg
cgcaagttcagccacggcacgccgaacgactggatcgaacgcaacctctactcgaagtac
ccgatcctcggcgtgagcctgatgatggtgatcgacgtcgcgctgttcggcgtgctcggc
ctgaccgtctgggccgtgcagatggtgtggatcccgttctgggcggccggtgtcgtcaac
ggcttcggtcacttctggggctatcgcaacttcaactcggccgacgcgagcacgaacctg
ttcccgtggggcatcgtgatcggcggcgaagagctgcacaacaaccaccacacgttcgcg
acgtcggcgaagctgtcgaacaagtggtacgagttcgacatcggctggatgtacatccgc
atcatgtcggccttcggtctcgcgaaggtgaagaaggtcgcgccgacgccgcgcctgaac
aagccgaagacggtgctcgaccaggaaacgctgcaggccgtgctgtcgaaccgctacgaa
gtgatggcgagctacggcaaggccgtgaagcgtgcgtaccgccaggagctcgcgcacctg
aaggaactcggttcgagcgagaagtaccagttgatgcgcggtgcccgcaagtggttccac
aaggacgccgacggtctcgacgagccgcagaagaagctgctgccggaaatcttcgcgaac
agccagaagctgcatacgtacttccagctgcgccaggatctggccgcgatctgggaccgt
tcgactgcgtcgcgcgaacagcttctcgcgcaattgcaggattggtgccatcgcgcagaa
caaagcggcatcaaggcgctgcaggaattcgcgacgcgtctgcgtcgctacgcctga

DBGET integrated database retrieval system