KEGG   Burkholderia cenocepacia J2315: BCAL2719Help
Entry
BCAL2719          CDS       T00771                                 

Definition
putative transmembrane fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bcj01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bcj01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2983773..2984969)
Genome map
AA seq 398 aa AA seqDB search
MLNSLLDFLSHGLLHFSWWQVALFALAVTHVTIIGVTVYLHRCQAHRALELHPIASHFFR
LWLWMTTGMLTGQWAAIHRKHHAKCETEEDPHSPQTRGIWKVFLEGAELYRAEAKNEETM
RKFSHGTPNDWIERNLYSKYPILGVSLMMVIDVALFGVLGLTVWAVQMVWIPFWAAGVVN
GFGHFWGYRNFNSADASTNLFPWGIVIGGEELHNNHHTFATSAKLSNKWYEFDIGWMYIR
IMSAFGLAKVKKVAPTPRLNKPKTVLDQETLQAVLSNRYEVMASYGKAVKRAYRQELAHL
KELGSSEKYQLMRGARKWFHKDADGLDEPQKKLLPEIFANSQKLHTYFQLRQDLAAIWDR
STASREQLLAQLQDWCHRAEQSGIKALQEFATRLRRYA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaattccctgctcgattttctttcccacgggctcctgcatttttcgtggtggcag
gtcgcgctgttcgcgctcgccgtcacgcacgtcacgatcatcggtgtgacggtctacctg
catcgctgccaggcgcaccgcgcgctggagctgcatccgatcgcgagccacttcttccgt
ctctggctgtggatgaccaccggcatgctgaccggccagtgggccgcgattcaccgcaag
caccatgcgaagtgcgagaccgaggaagatccgcacagcccgcagacgcgcggcatctgg
aaggtgttcctcgagggcgccgagctgtatcgcgcggaagcgaagaacgaagagacgatg
cgcaagttcagccacggcacgccgaacgactggatcgaacgcaacctctactcgaagtac
ccgatcctcggcgtgagcctgatgatggtgatcgacgtcgcgctgttcggcgtgctcggc
ctgaccgtctgggccgtgcagatggtgtggatcccgttctgggcggccggtgtcgtcaac
ggcttcggtcacttctggggctatcgcaacttcaactcggccgacgcgagcacgaacctg
ttcccgtggggcatcgtgatcggcggcgaagagctgcacaacaaccaccacacgttcgcg
acgtcggcgaagctgtcgaacaagtggtacgagttcgacatcggctggatgtacatccgc
atcatgtcggccttcggtctcgcgaaggtgaagaaggtcgcgccgacgccgcgcctgaac
aagccgaagacggtgctcgaccaggaaacgctgcaggccgtgctgtcgaaccgctacgaa
gtgatggcgagctacggcaaggccgtgaagcgtgcgtaccgccaggagctcgcgcacctg
aaggaactcggttcgagcgagaagtaccagttgatgcgcggtgcccgcaagtggttccac
aaggacgccgacggtctcgacgagccgcagaagaagctgctgccggaaatcttcgcgaac
agccagaagctgcatacgtacttccagctgcgccaggatctggccgcgatctgggaccgt
tcgactgcgtcgcgcgaacagcttctcgcgcaattgcaggattggtgccatcgcgcagaa
caaagcggcatcaaggcgctgcaggaattcgcgacgcgtctgcgtcgctacgcctga

DBGET integrated database retrieval system