KEGG   Burkholderia cenocepacia J2315: BCAL2915Help
Entry
BCAL2915          CDS       T00771                                 

Gene name
dfrA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00670  One carbon pool by folate
bcj00790  Folate biosynthesis
bcj01100  Metabolic pathways
Module
bcj_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCAL2915 (dfrA)
   00670 One carbon pool by folate
    BCAL2915 (dfrA)
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BCAL2915 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 peroxidase
Motif
Other DBs
NCBI-ProteinID: CAR53214
UniProt: B4EAM3
Position
1:3196499..3196999
Genome map
AA seq 166 aa AA seqDB search
MTTLTLIVARARNGIIGRDNQLPWKLPEDLAFFKRTTMGAPIVMGRKTHESIGRPLPGRR
NIVVTRDATRRFEGCDTVTSLADALALAARDGAPEAFLLGGAQLYAEGLTLADKLVVTEI
DADFDGDASFPAPDAAHWQEISRDAHQAAAPNTFGYAFVVYARKRG
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgttgaccctgatcgtcgcgcgtgcccgcaacggcatcatcggccgcgacaac
cagttgccctggaaacttcccgaggatctcgcgttcttcaagcgcacgacgatgggcgcg
ccgatcgtgatgggccgcaagacccacgagtcgatcgggcggccgctgccgggccgccgc
aatatcgtcgtcacgcgcgacgcgacgcgccgtttcgaaggctgcgacacagtcacgtcg
ctggccgatgcgctggcgctcgccgcgcgcgacggcgcacccgaggcattcctgctcggc
ggcgcgcaactctatgcggaaggtctcacgctcgccgacaagctggtcgtcaccgagatc
gatgcggacttcgacggcgacgcatcgttcccggcgcccgacgccgcgcactggcaggaa
atctcgcgcgacgcacatcaggcagccgcgccgaacacgttcggctatgcgttcgtcgtc
tacgcacgcaagcgcggctga

DBGET integrated database retrieval system