KEGG   Burkholderia cenocepacia J2315: BCAL3044Help
Entry
BCAL3044          CDS       T00771                                 

Gene name
glk
Definition
bifunctional glucokinase/RpiR family transcriptional regulator (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAL3044 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAL3044 (glk)
   00052 Galactose metabolism
    BCAL3044 (glk)
   00500 Starch and sucrose metabolism
    BCAL3044 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BCAL3044 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCAL3044 (glk)
   00524 Butirosin and neomycin biosynthesis
    BCAL3044 (glk)
Enzymes [BR:bcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BCAL3044 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3336630..3338558
Genome map
AA seq 642 aa AA seqDB search
MSTGAQSKAVVAGQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGADYPTLTDAIR
KYLKDVKISRVNHAAIAIANPVDGDQVTMTNHDWSFSIEATRRALGFDTLLVVNDFTALA
MALPGLTDAQRVQIGGGTRRQNSVIGLLGPGTGLGVSGLIPADDRWIALGSEGGHASFAP
QDEREDLVLQYARKKFPHVSFERVCAGPGMEIIYRALAARDKKRVAATVDTVEIVERAHA
GDALALETVECFCGILGAFAGSVALTLGALGGVYIGGGVALKLGELFTRSSFRARFEAKG
RFTHYLENIPTYLITAEYPAFLGVSAILAEQLSNRSGGASSAVFERIRQMRDALTPAERR
VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM
SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVENAIEILNGARRIEFYGLGNSN
IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQ
AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLLMIDILAVGVAIRRAS
TNGELPEAVAQAKARASDDETADVLDWLSHGASPAAKDVARD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaagtaaggcggtcgtcgcgggtcagcatgccgacggcccgcgc
ctgctcgcggacgtcggcggcaccaacgcgcgcttcgcgctggaaaccggccccggcgag
atcacgcagatccgcgtctatcccggcgccgactatccgacgctcaccgacgcgatccgc
aaatacctgaaggacgtgaagatcagccgcgtgaaccacgcggcgatcgcgatcgccaat
ccggtcgacggcgaccaggtcacgatgaccaaccacgactggagcttctcgatcgaggcg
acgcgccgcgcgctcggcttcgacacgctgctggtcgtcaacgacttcaccgcgctcgcg
atggcgctgccgggcctgaccgacgcgcagcgcgtgcagatcggcggcggcacgcgccgc
cagaacagcgtgatcggcctgctcgggccgggcaccgggctcggcgtgtcggggctgatt
ccggccgacgaccgctggatcgcgctcggcagcgaaggcggccacgcatcgttcgcgccg
caggacgagcgcgaggatctggtgctgcagtacgcgcgcaagaagtttccgcacgtgtcg
ttcgaacgcgtgtgcgcgggccccggcatggagatcatctatcgcgcgctcgccgcgcgc
gacaagaaacgtgtcgccgcgaccgtcgacacggtcgagatcgtcgagcgcgcgcatgcg
ggcgacgcgctcgcgctcgagacggtcgaatgcttctgcgggattctcggcgcgttcgcg
ggcagcgtcgcgctgacgctcggcgcgctcggcggcgtgtacatcggcggcggcgtcgcg
ctgaagctgggcgagctgttcacgcgctcgtcgttccgcgcacgcttcgaggcgaagggc
cgcttcacgcactatctcgagaacatcccgacctacctgatcaccgccgaatacccggcg
ttcctcggcgtgtcggcgattctcgcggagcagttgtcgaaccgctccggcggtgcgtcg
tcggccgtgttcgaacggatccgccagatgcgcgacgcgctgacgccggccgagcgccgc
gtggccgatctcgcgctgaaccatccgcgctcgatcatcaacgatccgatcgtcgacatc
gcgcgcaaggccgacgtgagccagccgaccgtgatccgcttctgccgctcgctcggctgc
caggggctgtcggacttcaagctgaagctcgccaccgggctcaccggcacgatcccgatg
agccacagccaggtgcatctcggcgacacggccaccgacttcggcgcgaaggtgctcgac
aacacggtgtccgcgatcctgcaactgcgcgagcacctgaatttcgagcacgtcgagaac
gcgatcgagatcctgaacggcgcgcgccgcatcgagttctacgggctcggcaactcgaac
atcgtcgcgcaggacgcgcactacaagttcttccgcttcgggattccgacgatcgcgtac
ggcgacctgtacatgcaggccgcgtcggccgcgctgctcggcaagggcgacgtgatcgtc
gcggtgtcgaagtcgggccgcgcgcccgagctgctgcgcgtgctcgacgtcgcgatgcag
gccggcgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgcgaagcgcgcgacc
gtcgcgctcgagaccgaccacatcgagatgcgcgagtcgcagttgtcgatgatctcgcgg
atcctgcatctgctgatgatcgacatcctcgcggtcggcgtcgcgatccgtcgcgcgtcg
acgaacggcgagctgcccgaggccgttgcccaggcgaaggcgcgcgccagcgacgacgaa
acggcagacgtgctcgactggctgagccacggcgcgtcgccggcggcgaaggacgtcgcg
cgggactga

DBGET integrated database retrieval system