KEGG   Burkholderia cenocepacia J2315: BCAL3044Help
Entry
BCAL3044          CDS       T00771                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00010  Glycolysis / Gluconeogenesis
bcj00052  Galactose metabolism
bcj00500  Starch and sucrose metabolism
bcj00520  Amino sugar and nucleotide sugar metabolism
bcj00521  Streptomycin biosynthesis
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
bcj01200  Carbon metabolism
Module
bcj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAL3044 (glk)
   00052 Galactose metabolism
    BCAL3044 (glk)
   00500 Starch and sucrose metabolism
    BCAL3044 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BCAL3044 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCAL3044 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BCAL3044 (glk)
Enzymes [BR:bcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BCAL3044 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6 SIS SIS_2 HTH_IclR LacI
Motif
Other DBs
NCBI-ProteinID: CAR53366
UniProt: B4EBS8
Position
1:3336630..3338558
Genome map
AA seq 642 aa AA seqDB search
MSTGAQSKAVVAGQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGADYPTLTDAIR
KYLKDVKISRVNHAAIAIANPVDGDQVTMTNHDWSFSIEATRRALGFDTLLVVNDFTALA
MALPGLTDAQRVQIGGGTRRQNSVIGLLGPGTGLGVSGLIPADDRWIALGSEGGHASFAP
QDEREDLVLQYARKKFPHVSFERVCAGPGMEIIYRALAARDKKRVAATVDTVEIVERAHA
GDALALETVECFCGILGAFAGSVALTLGALGGVYIGGGVALKLGELFTRSSFRARFEAKG
RFTHYLENIPTYLITAEYPAFLGVSAILAEQLSNRSGGASSAVFERIRQMRDALTPAERR
VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM
SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVENAIEILNGARRIEFYGLGNSN
IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQ
AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLLMIDILAVGVAIRRAS
TNGELPEAVAQAKARASDDETADVLDWLSHGASPAAKDVARD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaagtaaggcggtcgtcgcgggtcagcatgccgacggcccgcgc
ctgctcgcggacgtcggcggcaccaacgcgcgcttcgcgctggaaaccggccccggcgag
atcacgcagatccgcgtctatcccggcgccgactatccgacgctcaccgacgcgatccgc
aaatacctgaaggacgtgaagatcagccgcgtgaaccacgcggcgatcgcgatcgccaat
ccggtcgacggcgaccaggtcacgatgaccaaccacgactggagcttctcgatcgaggcg
acgcgccgcgcgctcggcttcgacacgctgctggtcgtcaacgacttcaccgcgctcgcg
atggcgctgccgggcctgaccgacgcgcagcgcgtgcagatcggcggcggcacgcgccgc
cagaacagcgtgatcggcctgctcgggccgggcaccgggctcggcgtgtcggggctgatt
ccggccgacgaccgctggatcgcgctcggcagcgaaggcggccacgcatcgttcgcgccg
caggacgagcgcgaggatctggtgctgcagtacgcgcgcaagaagtttccgcacgtgtcg
ttcgaacgcgtgtgcgcgggccccggcatggagatcatctatcgcgcgctcgccgcgcgc
gacaagaaacgtgtcgccgcgaccgtcgacacggtcgagatcgtcgagcgcgcgcatgcg
ggcgacgcgctcgcgctcgagacggtcgaatgcttctgcgggattctcggcgcgttcgcg
ggcagcgtcgcgctgacgctcggcgcgctcggcggcgtgtacatcggcggcggcgtcgcg
ctgaagctgggcgagctgttcacgcgctcgtcgttccgcgcacgcttcgaggcgaagggc
cgcttcacgcactatctcgagaacatcccgacctacctgatcaccgccgaatacccggcg
ttcctcggcgtgtcggcgattctcgcggagcagttgtcgaaccgctccggcggtgcgtcg
tcggccgtgttcgaacggatccgccagatgcgcgacgcgctgacgccggccgagcgccgc
gtggccgatctcgcgctgaaccatccgcgctcgatcatcaacgatccgatcgtcgacatc
gcgcgcaaggccgacgtgagccagccgaccgtgatccgcttctgccgctcgctcggctgc
caggggctgtcggacttcaagctgaagctcgccaccgggctcaccggcacgatcccgatg
agccacagccaggtgcatctcggcgacacggccaccgacttcggcgcgaaggtgctcgac
aacacggtgtccgcgatcctgcaactgcgcgagcacctgaatttcgagcacgtcgagaac
gcgatcgagatcctgaacggcgcgcgccgcatcgagttctacgggctcggcaactcgaac
atcgtcgcgcaggacgcgcactacaagttcttccgcttcgggattccgacgatcgcgtac
ggcgacctgtacatgcaggccgcgtcggccgcgctgctcggcaagggcgacgtgatcgtc
gcggtgtcgaagtcgggccgcgcgcccgagctgctgcgcgtgctcgacgtcgcgatgcag
gccggcgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgcgaagcgcgcgacc
gtcgcgctcgagaccgaccacatcgagatgcgcgagtcgcagttgtcgatgatctcgcgg
atcctgcatctgctgatgatcgacatcctcgcggtcggcgtcgcgatccgtcgcgcgtcg
acgaacggcgagctgcccgaggccgttgcccaggcgaaggcgcgcgccagcgacgacgaa
acggcagacgtgctcgactggctgagccacggcgcgtcgccggcggcgaaggacgtcgcg
cgggactga

DBGET integrated database retrieval system