KEGG   Burkholderia cenocepacia J2315: BCAL3113Help
Entry
BCAL3113          CDS       T00771                                 

Gene name
manB
Definition
phosphomannomutase (EC:5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAL3113 (manB)
   00030 Pentose phosphate pathway
    BCAL3113 (manB)
   00051 Fructose and mannose metabolism
    BCAL3113 (manB)
   00052 Galactose metabolism
    BCAL3113 (manB)
   00500 Starch and sucrose metabolism
    BCAL3113 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    BCAL3113 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    BCAL3113 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCAL3113 (manB)
Enzymes [BR:bcj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BCAL3113 (manB)
    5.4.2.8  phosphomannomutase
     BCAL3113 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3401971..3403365)
Genome map
AA seq 464 aa AA seqDB search
MISQSIFKAYDIRGVVGKTLDVDTARGIGRAFGSEVRAQGGDAVVVARDGRLSGPELVGA
LADGLRAAGVDVVDVGMVPTPVGYFAANVPLALKGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGEQIQALYRRIVDERFETGSGTYEAIDVADQYIARIVGDVKLARPLKLVVDA
GNGVAGPLATRLFKALGCELVERFTDIDGTFPNHHPDPAHPENLQDVIQALKDTDAELGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRHLAQWVKSKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLQEILAKTADP
SALLNSLPDAMSTPELQLWLDEGENFRLIEQLQKEAKFDGADEVVTIDGLRVEYPDGFGL
ARSSNTTPVVVMRFEAETQEGLKRIQEDFRRVLTAAKPDVKLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctcccaatccatcttcaaggcatatgacattcgtggcgtggtcggcaagaccctc
gacgtcgacacggcgcgcgggatcggccgggcattcggcagcgaagtgcgtgcgcagggc
ggcgatgcggtcgtcgtcgcgcgcgacggccgcctgtccggaccggagctggtcggcgcg
ctggccgacggcctgcgtgcggccggggtcgacgtcgtcgacgtcggcatggtgccgacg
ccggtcggttatttcgcggcgaacgtgccgctcgcgctgaagggcggcgagcgccgcgtc
gattcgtgcatcgtcgtcacgggcagccacaacccgcccgactacaacggcttcaagatg
gtgctgcgcggcgccgcaatctacggcgagcagatccaggcgctgtaccgccgcatcgtc
gacgagcggttcgagacgggcagcggcacgtatgaagcaatcgacgtcgcggatcagtac
atcgcgcgcatcgtcggcgacgtgaagctcgcgcggccgctgaagctcgtcgtcgacgcc
ggcaacggcgtcgcgggcccgctcgcgacgcgcctgttcaaggcgctcggctgcgaactc
gtcgagcgcttcaccgacatcgacggcacattcccgaaccaccaccccgatcctgcccac
ccggaaaacctgcaggacgtgatccaggcgctgaaggacaccgatgcggagctcggcttc
gcgttcgacggcgacggcgaccgtctcggcgtcgtcacgaaggacggccagatcatctat
ccggaccgccagctgatgctgttcgcggaagaagtgctgtcgcgcaatccgggcgcccag
atcatctacgacgtgaagtgcacgcgccacctcgcgcagtgggtgaagtcgaagggcggc
gagccgctgatgtggaagacgggccattcgctcgtgaaggcgaagctgcgcgagacgggt
gcaccgctcgccggcgaaatgagcggccacgtgttcttcaaggatcgctggtacggcttc
gacgacggcctgtacacgggcgcgcgcctgcaggaaattctcgcgaagacggccgatccg
agcgcgctgctcaacagcctgccggacgcgatgagcacgccggaactgcagctctggctc
gacgaaggcgagaatttccgcctgatcgagcagttgcagaaggaagcgaagttcgacggc
gccgacgaagtcgtgacgatcgacggcctgcgtgtcgagtacccggacggtttcggcctc
gcgcgttcgtcgaacacgacgccggtcgtcgtgatgcgcttcgaagccgagacgcaggaa
gggctcaagcgcatccaggaggacttccgccgcgtgctgacggccgcgaagccggacgtc
aagctgccgttctga

DBGET integrated database retrieval system