KEGG   Burkholderia cenocepacia J2315: BCAL3338Help
Entry
BCAL3338          CDS       T00771                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCAL3338 (ruvA)
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BCAL3338 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3656605..3657186
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGILLEKNPPHLLVDCNGVGYEIDVPMSTFYNLPQTGERVVLLTQQIVREDAHLL
YGFLTQQERTTFRELLKITGIGARMALAVLSGMSVQELAQAVTMQDAARLTRLPGIGKKT
AERLLLELKGKLGADLGALAGAASPSDHATDILNALLALGYSEKEGLAAIKNVPAGTGVS
EGIKLALKALSKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcatcgccggcatcctgctcgaaaagaacccgcctcatctgctcgtcgac
tgcaacggcgtcggctacgaaatcgacgtgccgatgagcaccttctacaacctgccgcaa
acgggcgaacgcgtcgtgctgctcacgcagcagatcgtccgcgaggacgcgcacctgctg
tacggcttcctgacgcagcaggagcgcacgaccttccgcgaactgctgaagatcaccggc
atcggcgcgcgcatggcgctcgccgtgctgtccggcatgagcgtgcaggaactcgcgcag
gccgtgacgatgcaggacgccgcccgcctcacgcgcctgcccggcatcggcaagaagacc
gccgagcgcctgctgctcgaactgaagggcaagctcggcgccgacctcggcgcgctcgcc
ggcgccgcgtcgccgtccgaccacgcgaccgacatcctcaacgcactgctggcgctcggc
tactccgagaaggaaggccttgccgcgatcaagaacgtaccggccggcaccggcgtgtcc
gaaggcatcaagctcgcgctgaaggcattgtcgaaggcgtaa

DBGET integrated database retrieval system