KEGG   Burkholderia cenocepacia J2315: BCAL3338Help
Entry
BCAL3338          CDS       T00771                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bcj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3656605..3657186
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGILLEKNPPHLLVDCNGVGYEIDVPMSTFYNLPQTGERVVLLTQQIVREDAHLL
YGFLTQQERTTFRELLKITGIGARMALAVLSGMSVQELAQAVTMQDAARLTRLPGIGKKT
AERLLLELKGKLGADLGALAGAASPSDHATDILNALLALGYSEKEGLAAIKNVPAGTGVS
EGIKLALKALSKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcatcgccggcatcctgctcgaaaagaacccgcctcatctgctcgtcgac
tgcaacggcgtcggctacgaaatcgacgtgccgatgagcaccttctacaacctgccgcaa
acgggcgaacgcgtcgtgctgctcacgcagcagatcgtccgcgaggacgcgcacctgctg
tacggcttcctgacgcagcaggagcgcacgaccttccgcgaactgctgaagatcaccggc
atcggcgcgcgcatggcgctcgccgtgctgtccggcatgagcgtgcaggaactcgcgcag
gccgtgacgatgcaggacgccgcccgcctcacgcgcctgcccggcatcggcaagaagacc
gccgagcgcctgctgctcgaactgaagggcaagctcggcgccgacctcggcgcgctcgcc
ggcgccgcgtcgccgtccgaccacgcgaccgacatcctcaacgcactgctggcgctcggc
tactccgagaaggaaggccttgccgcgatcaagaacgtaccggccggcaccggcgtgtcc
gaaggcatcaagctcgcgctgaaggcattgtcgaaggcgtaa

DBGET integrated database retrieval system