KEGG   Burkholderia cenocepacia J2315: BCAL3394Help
Entry
BCAL3394          CDS       T00771                                 

Definition
putative exported ribonuclease
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bcj  Burkholderia cenocepacia J2315
Brite
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     BCAL3394
Transfer RNA biogenesis [BR:bcj03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    BCAL3394
 Prokaryotic Type
    BCAL3394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3718511..3718942)
Genome map
AA seq 143 aa AA seqDB search
MARKWLRNGALASVFAMFAMGIVGTPTGSLVSAAYAREAVPADVAASGLDTIPTASLPRE
AVTTLSLIAAGGPYPYEKDGVVFGNRERILPKAKRGYYHEYTVPTPRARNRGARRIVCGG
PLRRIDNCYYTGDHYNSFKRIVE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctcgcgtccgtcttcgcgatgttcgcgatg
ggtatcgtcggcacgccgacgggcagtctggtttccgccgcttacgcacgggaggccgtt
ccggccgacgtggctgccagcgggctcgatacgatcccgactgccagtcttccgcgcgag
gccgtgaccacgctaagcctgatcgccgccggcggcccctatccgtacgagaaagacggc
gtcgtattcggcaatcgcgagcggatcctgccgaaggcgaagcgcggctactaccatgag
tacacggtgccgacgccgcgtgcgcgcaatcgcggcgcgcgccggatcgtctgtggcggt
ccgttgcgccggatcgacaactgttattacacgggcgaccactacaacagttttaaacgt
attgttgaatga

DBGET integrated database retrieval system