KEGG   Burkholderia cenocepacia J2315: BCAM0092Help
Entry
BCAM0092          CDS       T00771                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bcj  Burkholderia cenocepacia J2315
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:103498..104313
Genome map
AA seq 271 aa AA seqDB search
MTGRTGVLLIHGLGGTQYDLGSLHKAMRRAGGDTHMITLPGHGTRPEDLVGVRAEAWLDA
VTEQYRALAREYDTLHVAGMCMGALVALLLCHRVQHARGRLALLATPMFIDGWSTPWYRS
LRHVLYRVPGVAERMRVEEGDPFGIKNATIRAIVKKKFERQDSFHYAWVPLACVRQVDRM
RDWALDAAAGTPCPTLVLHAREDELTSLRSADFLLENMPDACGIVLENSYHMICADNDRD
DVARHVLEFFGFDPVHAVSPAMARRMGRLEP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacgggccgcacgggcgtgctgctgatccacgggctcggcggcacgcaatacgatctc
ggttcgctgcacaaggcgatgcggcgcgcgggcggcgatacgcacatgatcacgctgccg
gggcacggcacgcgcccggaggatctggtcggcgtgcgcgcggaggcgtggctcgatgcg
gtgaccgaacaataccgcgcgctggcgcgcgagtacgacacgctgcacgtcgcggggatg
tgcatgggcgcgctcgtcgcgctgctgctgtgtcatcgcgtgcagcatgcgcgcggccgg
ctcgcgctgctggcgacgccgatgttcatcgacggctggtcgacgccgtggtaccggtcg
ctgcggcacgtgctgtaccgcgtgccgggtgtcgccgagcgaatgcgcgtggaggaaggc
gatccgttcggcatcaagaacgcgacgatccgcgcgatcgtgaagaagaagttcgagcgg
caggacagtttccactatgcgtgggtgccgctcgcgtgcgtgcggcaggtggaccggatg
cgcgactgggcgctcgacgccgcggccggcacgccgtgcccgacgctcgtgctgcatgcg
cgcgaggacgagctgacgagcctgcgctcggccgatttcctgctggagaacatgcccgat
gcgtgcgggatcgtgctggagaacagctatcacatgatctgcgcggacaacgatcgcgac
gacgtcgcgcggcacgtgctcgaattcttcggcttcgatcccgtgcatgcggtaagcccg
gcgatggcgcgcaggatggggcggctggaaccttga

DBGET integrated database retrieval system