KEGG   Burkholderia cenocepacia J2315: BCAM0286Help
Entry
BCAM0286          CDS       T00771                                 

Definition
putative alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCAM0286
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAM0286
  Lipid metabolism
   00071 Fatty acid degradation
    BCAM0286
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCAM0286
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCAM0286
   00626 Naphthalene degradation
    BCAM0286
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCAM0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:337347..338336
Genome map
AA seq 329 aa AA seqDB search
MLAMMFDGTTPHLRETRVPDPSPAAGQLLIDVHACGVCRTDLHVVDGELAHAKLPLIPGH
QIVGTVRGLGEGVMSFAVGDRVGVPWLGSTCGHCAYCISGRENLCDNPGFTGYTIDGGYA
ECAVADHRYCVHLPRRYSDLEAAPLLCAGLIGYRTLRMAGDARRIGIYGFGAAAHLVAQV
AQGEGRKVFALTKPGDTAAQQLALSLGAAWAGGSDEAPPERLDAALIFAPAGALVPAALR
ALDKGGIVVCGGIHMSDIPSFPYAWLWGERRIASVANLTRADAVAFMRIAAATPLRVEAV
RYALTDANSALDDLRGGRVSGAAVLGMHD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcgatgatgtttgacggcacgacgccgcatttacgcgaaacgcgcgtgcctgac
ccgtcgcctgcggcgggtcagttgctgatcgacgtgcatgcgtgcggggtgtgcaggact
gatctccacgtggtcgacggcgaactcgctcacgcgaaactgccgctgattccggggcac
cagatcgtcggcacggtgcgcgggctgggcgaaggcgtgatgagcttcgccgtcggcgac
cgggtgggcgtcccgtggctgggctcgacatgcgggcattgcgcatattgcatatccggc
cgcgaaaatctgtgcgacaacccgggtttcacgggctatacgatcgacggcggctatgcc
gagtgcgcggtcgccgaccaccggtattgcgtgcatctgccacggcgctattccgatctg
gaagccgcgccgctgctgtgcgccggcctgatcggttaccggaccttgcggatggcgggc
gatgcgcgccgtatcggcatctacggcttcggtgcggcggcgcatctggtcgcgcaggtc
gcgcagggtgagggacgcaaggtgttcgcattgacgaagcccggcgacaccgcggcgcag
caattggcgttgtcgctgggcgcggcatgggccggcggcagcgacgaagcaccgccggag
cggctcgatgccgcgctgattttcgcgccggcgggggcgctggtgccggccgcgctgcgg
gcgctcgacaaaggcgggatcgtcgtatgcggcggcattcacatgagcgacatcccgagc
tttccgtacgcgtggctgtggggcgagcgccgcatcgcgtcggtggccaacctgacgcgt
gcggatgcggtcgcattcatgcggatcgccgccgcgacgccgctgcgggtcgaggcagtg
cgctacgcgctgactgacgcgaacagcgcactcgacgacctacgcggcggacgcgtgtca
ggtgccgccgtgctgggcatgcacgattga

DBGET integrated database retrieval system