KEGG   Burkholderia cenocepacia J2315: BCAM0311Help
Entry
BCAM0311          CDS       T00771                                 

Definition
putative 6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bcj01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bcj01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bcj00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bcj00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bcj00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bcj00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:bcj00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:365974..366909
Genome map
AA seq 311 aa AA seqDB search
MTGIVTVTLNPAVDVATSVEHIVDTHKLRCARPRRDPGGGGINVARTVHRLGGDCVALYL
AGGPTGDVLTALLEAEHLPSERIRIAGETRENVCVTETATGREYRFLMPGPLVTGAEWRA
CAARTDAMQPSPRYLVLSGSLPPGAPDDLYATLARTAKARGSRVVVDAAGRALQAALKAG
VHLVKPSIGELSALAGEPLDDTSACRKASELVARGQADIVALTLGARGAWVVTRDRTLRL
PGRPAAVCSTVGAGDSFVGGMVWALACGVPFDDACRYALAASAASVERPGTALCTRDDVE
RIHAELVAQAS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcatcgttaccgtcacattgaatcccgccgtcgatgttgctacgtcggtcgag
cacatcgtcgatacgcacaagctgcgctgcgcgcggccgcggcgcgaccccggcggcggc
ggaatcaacgtcgcccggaccgttcaccgactcggaggcgactgcgtcgcgctgtacctg
gccggcgggccgaccggcgacgtcctgacggcgctgctcgaagccgagcatctgccgagt
gagcgaatccggatcgccggcgagacccgcgagaacgtttgcgtgacagagaccgcgacc
ggacgtgaataccgcttcctgatgccggggccgctggtcacgggtgcggagtggcgcgcc
tgcgcggcgcgcaccgacgccatgcaaccgtcgccgcgctatctcgtgttgagcggaagc
ctgccgcccggcgcccccgacgatctctacgcgacgcttgcgcggacggcgaaggcaagg
ggcagccgcgtggttgtcgacgcggcgggccgggcgctgcaggcggccctcaaggccggt
gtccatctcgtcaagcccagtattggcgaactgagcgcgctggccggcgaaccgctcgac
gacacgtcggcatgccggaaggcgagcgaactcgtggcgcgcggccaggccgacatcgtc
gcgttgacactcggcgcacgcggcgcatgggtcgtcacgcgcgatcgcaccctgcgcctg
cccggcaggcccgcagcggtgtgcagcacggtcggcgccggagacagtttcgtcggcggc
atggtgtgggcgctggcgtgcggcgtgccgttcgacgatgcgtgccgctacgcgctggcg
gcatcggcggcgtctgtcgaacgtcccgggacggcgctgtgcacgcgcgacgacgtcgag
cggattcacgccgaactggttgcgcaggcaagctga

DBGET integrated database retrieval system