KEGG   Burkholderia cenocepacia J2315: BCAM0311Help
Entry
BCAM0311          CDS       T00771                                 

Definition
(GenBank) putative 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00010  Glycolysis / Gluconeogenesis
bcj00030  Pentose phosphate pathway
bcj00051  Fructose and mannose metabolism
bcj00052  Galactose metabolism
bcj00680  Methane metabolism
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
bcj01200  Carbon metabolism
bcj01230  Biosynthesis of amino acids
Module
bcj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAM0311
   00030 Pentose phosphate pathway
    BCAM0311
   00051 Fructose and mannose metabolism
    BCAM0311
   00052 Galactose metabolism
    BCAM0311
  Energy metabolism
   00680 Methane metabolism
    BCAM0311
Enzymes [BR:bcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BCAM0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: CAR54170
UniProt: B4EIQ2
Position
2:365974..366909
Genome map
AA seq 311 aa AA seqDB search
MTGIVTVTLNPAVDVATSVEHIVDTHKLRCARPRRDPGGGGINVARTVHRLGGDCVALYL
AGGPTGDVLTALLEAEHLPSERIRIAGETRENVCVTETATGREYRFLMPGPLVTGAEWRA
CAARTDAMQPSPRYLVLSGSLPPGAPDDLYATLARTAKARGSRVVVDAAGRALQAALKAG
VHLVKPSIGELSALAGEPLDDTSACRKASELVARGQADIVALTLGARGAWVVTRDRTLRL
PGRPAAVCSTVGAGDSFVGGMVWALACGVPFDDACRYALAASAASVERPGTALCTRDDVE
RIHAELVAQAS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcatcgttaccgtcacattgaatcccgccgtcgatgttgctacgtcggtcgag
cacatcgtcgatacgcacaagctgcgctgcgcgcggccgcggcgcgaccccggcggcggc
ggaatcaacgtcgcccggaccgttcaccgactcggaggcgactgcgtcgcgctgtacctg
gccggcgggccgaccggcgacgtcctgacggcgctgctcgaagccgagcatctgccgagt
gagcgaatccggatcgccggcgagacccgcgagaacgtttgcgtgacagagaccgcgacc
ggacgtgaataccgcttcctgatgccggggccgctggtcacgggtgcggagtggcgcgcc
tgcgcggcgcgcaccgacgccatgcaaccgtcgccgcgctatctcgtgttgagcggaagc
ctgccgcccggcgcccccgacgatctctacgcgacgcttgcgcggacggcgaaggcaagg
ggcagccgcgtggttgtcgacgcggcgggccgggcgctgcaggcggccctcaaggccggt
gtccatctcgtcaagcccagtattggcgaactgagcgcgctggccggcgaaccgctcgac
gacacgtcggcatgccggaaggcgagcgaactcgtggcgcgcggccaggccgacatcgtc
gcgttgacactcggcgcacgcggcgcatgggtcgtcacgcgcgatcgcaccctgcgcctg
cccggcaggcccgcagcggtgtgcagcacggtcggcgccggagacagtttcgtcggcggc
atggtgtgggcgctggcgtgcggcgtgccgttcgacgatgcgtgccgctacgcgctggcg
gcatcggcggcgtctgtcgaacgtcccgggacggcgctgtgcacgcgcgacgacgtcgag
cggattcacgccgaactggttgcgcaggcaagctga

DBGET integrated database retrieval system