KEGG   Burkholderia cenocepacia J2315: BCAM0390Help
Entry
BCAM0390          CDS       T00771                                 

Definition
putative alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCAM0390
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BCAM0390
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCAM0390
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BCAM0390
Exosome [BR:bcj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCAM0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:441961..443352
Genome map
AA seq 463 aa AA seqDB search
MSTIKCIAAALAVAGFACGAAQAAGQAKNVIFFLGDGMGPTTVTASRIYKVGESGQLTME
KLARTARVKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSMSSDTRAVAPGSDVNGNKTVN
HCAPGNGQPVATLLELAKARGKAVGAITTTELTHATPAATYSHICHRDAQYDIAAQAAPG
GAGYNAALGDGVDVLMGGGRNHWTPFDPVSNKRGRADGRNLLDEMKAKGYTVVATRDQLA
QAGNGKLVGLFSSTSHLEYELDRVAGKGEGPTQPSLADMTSKAIDVLSKNSNGYFLMVEG
GRIDHALHGTNAKRALEDTAAFDEAIRVALSKVDLANTLIVVTADHDHTMTINGYSKRGN
PILDISRNYRDGQPSKDADGNTYTTLVFGNGANRPNVRASVDSATAMNEAYLQEVGVRMG
SAGSETHGGGDVMLFADGADAKAFKGTIDNTKVFGLVRSAFGF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccatcaagtgcatcgcggcggcgctggccgtcgcgggtttcgcgtgcggcgcg
gcgcaggccgccggccaggcgaagaacgtgatcttctttctcggcgacggcatggggccg
acgaccgtgaccgcgagccggatctacaaggtcggcgagtcggggcaactgacgatggag
aagctggcccgcaccgcgcgcgtcaagaccttctcgaacgacgcgcagacgaccgacagc
gcgccgtcgatggccgcgtacatgaccggcgtgaagatgaacaacgaagtgctgtcgatg
tcgtccgacacgcgcgcggtcgcgccgggcagcgacgtcaacggcaacaagaccgtcaac
cattgcgcaccgggcaacggccagccggtcgcgacgctgctggaactggcgaaggcgcgc
ggcaaggcggtcggcgcgatcacgaccaccgagctcacgcatgcgacgccggccgcgacc
tattcgcacatctgccatcgcgatgcgcagtacgacatcgccgcgcaggccgcgcccggc
ggcgcgggctacaacgcggcgctcggcgacggcgtcgacgtgctgatgggcggcggccgc
aaccactggacgccgttcgatccggtgtcgaacaagcgcggccgtgccgacgggcgcaac
ctgctcgacgagatgaaggcgaagggctacacggtcgtcgcgacccgggatcagctcgcg
caggccggcaacggcaagctggtcggtctcttcagctcgacgagccatctcgagtacgaa
ctcgatcgggtcgcgggcaagggcgaagggccgacgcagccgagcctggccgacatgacg
tcgaaggcgatcgacgtgctgtccaagaattcgaacggctatttcctgatggtcgaaggc
ggccggatcgatcacgcgctgcacggcaccaacgcgaagcgcgcgctcgaagacacggcg
gcgttcgacgaagcgatccgcgtcgcgctgtcgaaggtcgacctggcgaatacgctgatc
gtcgtgacggccgaccacgaccacacgatgacgatcaacggctattcgaagcgcggcaac
ccgattctcgacatcagccgcaactatcgcgacggtcagccgagcaaggatgccgacggc
aatacctacacgacgctggtgttcggcaacggcgccaaccggccgaacgtgcgtgcgtcg
gtcgattcggccaccgcgatgaacgaagcgtacctgcaggaagtcggcgtgcggatgggc
agcgcgggatcggagacgcacggcggcggcgacgtgatgctgttcgccgacggcgcggac
gcgaaggcgttcaagggcacgatcgacaacacgaaggtgttcggtctcgtgcgctcggcg
ttcggcttctga

DBGET integrated database retrieval system