KEGG   Burkholderia cenocepacia J2315: BCAM0826Help
Entry
BCAM0826          CDS       T00771                                 

Gene name
cheB2
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCAM0826 (cheB2)
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BCAM0826 (cheB2)
Two-component system [BR:bcj02022]
 CheA family
  WspE-WspRF [MD:M00509]
   BCAM0826 (cheB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:912655..913674
Genome map
AA seq 339 aa AA seqDB search
MNIGIVNDLPLAVEALRRVIALRADHRVLWVATDGDEAVDFCVAHPPDVVLMDLVMPKVD
GVAATRRIMARAPCAILIVTASVSANTSSVYEAMGAGALDAVDTPTLALGLSTDASPQAL
LAKIDQIGRLLESRSVALVPPGPAPTRGQPTLVAIGASAGGPTALTALLRALPADFPAAI
VIVQHVDQAFAYGMAEWLDGYTRLPVRVARQGSVPEAGAVLLAATNDHLTLSPRGVLGYT
RHPAETPYRPSIDVFFNSVADGWQSDALGVLLTGMGRDGALGLKAMRAKGCYTIAQDEAT
SAVYGMPKAAAAIGAASAILPLEQIAPQLIARIALAPRD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcggcatcgtcaacgacctgccgctggccgtggaggcgctgcgccgcgtgatc
gcgctgcgtgcggaccatcgcgtgctgtgggtcgcgaccgatggcgacgaggcggtggat
ttctgcgtcgcgcatccgcccgacgtcgtgctgatggatctcgtgatgccgaaagtcgac
ggcgtcgccgcgacgcgccggatcatggcgcgcgcgccatgcgcgatcctgatcgtgacg
gcgagcgtcagcgcgaacacgtcgtcggtgtacgaggcgatgggcgccggcgcgctcgat
gcggtcgacacgccgacgctcgcgctcggcctgtcgaccgacgcatcgccgcaggcgctg
ctcgcgaagatcgaccagatcggccggctgctcgaaagccgctccgtggcgctcgtgccg
ccggggccggcgcccacgcgcggacagccgacgctcgtcgcgatcggtgcgtcggcgggc
gggccgaccgcgctcaccgcgctgctgcgcgcgttgccggccgatttcccggccgcgatc
gtgatcgtccagcacgtcgaccaggcattcgcgtacggcatggccgaatggctcgacggc
tatacgcggctgccggtgcgcgtcgcgcggcagggcagcgtgcccgaggccggcgcggtg
ctgctcgcggcgaccaacgaccatctgacgctgtcgccgcgcggcgtgctcggctatacg
cggcatccggccgaaacgccgtaccggccgtcgatcgacgtgttcttcaacagcgtcgcg
gacggctggcagagcgatgcgctcggcgtgctgctgaccggcatggggcgcgacggcgcg
ctcggcctgaaggcgatgcgggcgaagggctgctacacgatcgcgcaggacgaagcgacc
agcgccgtgtacgggatgccgaaggcggcggcggcgatcggcgcggcgtcggcgatcctg
ccgctcgaacagatcgcgccccagttgatcgcgcggatcgcgctcgcgccgcgcgactga

DBGET integrated database retrieval system