KEGG   Burkholderia cenocepacia J2315: BCAM0968Help
Entry
BCAM0968          CDS       T00771                                 

Definition
putative succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAM0968
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCAM0968
   00650 Butanoate metabolism
    BCAM0968
  Energy metabolism
   00190 Oxidative phosphorylation
    BCAM0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1073192..1073560
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLVLFFGAHDFSYEGWASIFA
AQWMKLATFVMLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaacaaccgaatcggctcgaagcgcctcgtcgtcggcgcacactacggcctg
cgcgactggctcgcgcagcgcgtcaccgccacgatcatggcggtctacacggtcattctg
ctcgtcctgttcttcggcgcgcacgatttttcgtacgaaggctgggcatcgatcttcgcc
gcgcaatggatgaagctcgcgaccttcgtgatgctgctttccctcttctaccacgcatgg
gtcggcgtgcgcgacatctggatggactacgtgaagcccgtcggtgtgcgcctgctgctg
caatcgctgaccatcgtctggctgctcgcatgtgcgggctacgccgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system