KEGG   Burkholderia cenocepacia J2315: BCAM0968Help
Entry
BCAM0968          CDS       T00771                                 

Definition
(GenBank) putative succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00020  Citrate cycle (TCA cycle)
bcj00190  Oxidative phosphorylation
bcj00650  Butanoate metabolism
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
bcj01200  Carbon metabolism
Module
bcj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bcj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCAM0968
   00650 Butanoate metabolism
    BCAM0968
  Energy metabolism
   00190 Oxidative phosphorylation
    BCAM0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: CAR54825
UniProt: B4EFB3
Position
2:1073192..1073560
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLVLFFGAHDFSYEGWASIFA
AQWMKLATFVMLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaacaaccgaatcggctcgaagcgcctcgtcgtcggcgcacactacggcctg
cgcgactggctcgcgcagcgcgtcaccgccacgatcatggcggtctacacggtcattctg
ctcgtcctgttcttcggcgcgcacgatttttcgtacgaaggctgggcatcgatcttcgcc
gcgcaatggatgaagctcgcgaccttcgtgatgctgctttccctcttctaccacgcatgg
gtcggcgtgcgcgacatctggatggactacgtgaagcccgtcggtgtgcgcctgctgctg
caatcgctgaccatcgtctggctgctcgcatgtgcgggctacgccgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system