KEGG   Burkholderia cenocepacia J2315: BCAM0993Help
Entry
BCAM0993          CDS       T00771                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCAM0993 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCAM0993 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCAM0993 (trpA)
Enzymes [BR:bcj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCAM0993 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:1100292..1101107
Genome map
AA seq 271 aa AA seqDB search
MSRIQQTFAALAEQGRKGLIPFITAGDPDPAKTVEFMHALAAGGADVIELGVPFSDPMAD
GPVIQRSSERALARGVTLKSVLADVKRFRETDPKTPVVLMGYANPIERMGVDAFAAEAHA
AGVDGVLVVDYPPEEAGVFAEKMRAAQIDPIFLLAPTSTDERIADVGKIASGYVYYVSLK
GVTGAGNLDVSSIAGKIPAIKSRVPVPVGVGFGIRDAETARAVAEVSDAVVIGSRLVQLL
ESAAPEGAAAALKTFIAELRAALDGAGKTAR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtattcagcagaccttcgccgcgctcgccgaacaaggccgtaagggcctgatc
ccgttcatcacggccggcgatcccgatcccgcgaaaaccgtcgaattcatgcacgcgctc
gccgcaggcggcgcggacgtgatcgagctcggcgtgccgttctcggacccgatggccgac
ggcccggtgatccagcgctcgtcggaacgcgcgctcgcgcgcggcgtcacgttgaagagc
gtgctcgccgacgtgaagcgtttccgcgaaaccgaccccaaaacccccgtcgtgctgatg
ggctatgcgaacccgatcgaacggatgggtgtcgatgcgttcgcggccgaagcgcacgcg
gccggcgtcgacggcgtgctggtggtcgactatccgccggaagaggccggtgttttcgcc
gagaaaatgcgcgccgcgcagatcgatccgatcttcctgctggcgcccacgtcgaccgac
gagcgcattgccgacgtcggcaagatcgcgagcggctacgtgtattacgtgtcgctcaag
ggcgtgaccggcgcgggaaatctggatgtttcgagcattgcaggtaaaatcccggccatc
aagtcgcgcgtgccggttccggtgggcgtcggcttcggtatccgcgacgccgaaacggcg
cgcgcggtggccgaagtgtcggatgccgtcgtgatcggcagccgcctggtgcagctgctc
gagagcgccgcgccggaaggcgccgccgccgcgctgaagactttcattgccgagctgcgt
gccgcgctggacggcgcgggcaagacggcgcgataa

DBGET integrated database retrieval system