KEGG   Burkholderia cenocepacia J2315: BCAM1010Help
Entry
BCAM1010          CDS       T00771                                 

Gene name
gtaB
Definition
putative UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCAM1010 (gtaB)
   00052 Galactose metabolism
    BCAM1010 (gtaB)
   00500 Starch and sucrose metabolism
    BCAM1010 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BCAM1010 (gtaB)
Enzymes [BR:bcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCAM1010 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1123104..1123991
Genome map
AA seq 295 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKPSHVNCFYVRQPEALGLGHAVLCAEK
LVHGEPFAVILADDLLHGEQPVLKQLVDVFDHYHSSVIGVETIPREDSRSYGVVEGREWE
EDIIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRKLKPGAGGELQLTDAVQSLLA
NEQVLAYRYYGTRFDCGSKLGYLKATVELALQHPEVSREFEAYLRTCLPALAAVA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggccgtgttccccgttgccggtctcggcacgcggttcctcccg
gcaacgaaggcgagcccgaaggaaatgctgcccgtcgtcgacaagccgctgattcagtac
gcggtcgaggaagcgatcaacgccggtatcaccgagatgatcttcgtcaccgggcgcagc
aagcgcgcgatcgaggatcatttcgacaagtcgtacgagatcgaggccgagctcgaggcg
cgcggcaaggaaaagctgctcgaactcgtgcgcggcatcaagccgagccacgtcaactgc
ttctacgtgcgccagccggaagcgctcggcctcggccacgcggtgctgtgcgcggagaag
ctggtgcacggcgagccgttcgcggtgatcctcgccgacgacctgctgcacggcgaacag
ccggtgctcaagcagctcgtcgacgtgttcgaccactatcacagctcggtgatcggggtc
gagacgatcccgcgcgaggacagccgctcgtacggcgtcgtcgaaggccgggagtgggaa
gaggacatcatcaagctgtcgggcatcatcgagaagccggcgccggaggatgcgccgtcg
aacctcggcgtggtcggccgctacgtgttcatgccgacgatcttcgatcatctgcgcaag
ctcaagccgggcgcgggcggcgaattgcagctcaccgacgccgtccagtcgctgctcgcg
aacgagcaggtgctcgcgtatcgctactacggcacgcgcttcgactgcggcagcaagctc
ggctatctcaaggccaccgtcgagctcgcgctccagcatccggaagtgagccgcgaattc
gaggcgtacctgcgtacctgcttgcccgcgctggctgccgtcgcttaa

DBGET integrated database retrieval system