KEGG   Burkholderia cenocepacia J2315: BCAM1104Help
Entry
BCAM1104          CDS       T00771                                 

Definition
putative glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BCAM1104
Enzymes [BR:bcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BCAM1104
Exosome [BR:bcj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCAM1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1193064..1194605
Genome map
AA seq 513 aa AA seqDB search
MTESRNAILAIDEGTSGTRAALVDASGHVSCLEYLPLSVESPQPGVVEQDANAILDKTLA
VCRATLAQAHQQHVRIVALALATQRATAVLWDTRTGRALVPAMVWQDTRHAAELDRLAAD
WDRVLVPQVGRPAGVRSPYLWAVHQLRTSRAVADAHRAGRLAFGTIDTWLLWHLSEARAC
MTTPTNATSASAYLLGEHRYFDPWLDALGFPRELLPALREDADAFGHTRADVLGIDVPIL
ACAGDQFAGAVGLGCVERGQAMCVHGTGSFVDLLTGTARPDAGSHAQPGHAHDGTLAMTA
RRHGGVSHYSLETFVATTGSALRWVCEKLRWFDDPAQISALAGTVRSARGVTFVPALTGL
RVPRMEPNARALLSGISIATTQAEVAHAVLEGIAHSVASCMEANEAVARAGVSELIVGGG
LAGSDTLLQIQADVSGVPVRRMRDGDRASLRGAAFLAGASGLLWESLEAARATLVTDAVF
EPSIDADSRQRRRAAWHARIASELAHAADFAHA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatcccgaaacgccattctcgcgatcgacgaaggcacgtccggcacgcgcgcc
gcgctcgtcgacgcgagcggccacgtgtcgtgcctggaatacctgccgctgtcggtcgag
agcccgcagcccggcgtcgtcgaacaggacgcgaacgcaatcctcgacaagacgctcgcc
gtctgccgtgcgacgctcgcgcaggcgcatcaacagcacgtgcgcatcgtcgcgctggcg
ctcgcgacgcagcgtgcgaccgccgtgctgtgggacacgcggaccgggcgcgcgctcgtg
cccgcgatggtctggcaggacacgcgccatgcggccgagctcgaccgtctcgcggccgac
tgggaccgcgtgctggtgccgcaggtcggccggccggcgggggtgcgctcgccgtatctg
tgggccgtgcaccagttgcgtacgtcgcgcgcggtggccgatgcgcatcgcgccggccgt
ctcgcgttcggcacgatcgacacgtggctgctgtggcatctgtccgaggcacgcgcgtgc
atgacgacgccgaccaacgcgacgtccgccagcgcgtacctgctcggcgagcatcgctat
ttcgacccgtggctcgacgcactcggctttccgcgcgaactgctgccggcgctgcgcgag
gacgccgacgcgttcggccacacgcgcgcggacgtgctcggcatcgacgtgccgatcctc
gcgtgcgcgggcgaccagttcgcgggcgcggtcggcctcggctgcgtcgagcgcggccag
gcgatgtgcgtgcacggcaccggcagcttcgtcgacctgctgacggggacggcgcgcccc
gacgccggatcgcatgcgcaacccggccacgcgcacgacggcacgctggcgatgaccgcg
cggcggcacggcggcgtgtcgcattactcgctcgaaaccttcgtcgcgacgaccggctcg
gcgttgcgctgggtctgcgaaaagttgcgctggttcgacgaccccgcgcagatcagcgcg
ctggctggcaccgtgcggtcggcgcgcggcgtgaccttcgtgccggcgctcaccggcctg
cgcgtgccgaggatggagccgaacgcgcgtgcgctgctgtcaggcatctcgatcgcgacg
acgcaggccgaggtcgcgcacgcggtgctcgaaggcatcgcgcattcggtcgcgtcgtgc
atggaggcgaacgaggcggtcgcgcgggccggcgtgtcggagctgatcgtcggcggcggc
ctcgcgggcagcgacacgctgctgcagatccaggccgacgtgagcggcgtgccggtgcgc
cggatgcgcgacggcgatcgcgcgagcctgcgcggcgcggcgtttctcgcgggcgcgtcg
gggttgctgtgggaatcgctcgaggcggcccgtgcgacgctcgtcaccgacgccgtcttc
gaaccgtcgatcgatgcggacagccggcagcggcggcgcgcggcctggcatgcgcggatc
gcgtccgagctcgcgcacgcggccgattttgctcatgcgtaa

DBGET integrated database retrieval system