KEGG   Burkholderia cenocepacia J2315: BCAM1268Help
Entry
BCAM1268          CDS       T00771                                 

Definition
(GenBank) putative FAD-binding oxidoreductase
  KO
K21061  
D-hydroxyproline dehydrogenase [EC:1.5.99.-]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Arginine and proline metabolism
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BCAM1268
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     BCAM1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:1394171..1395298
Genome map
AA seq 375 aa AA seqDB search
MSETKTDVVVIGAGIVGAACAHELAQRGLRVLVVDDASGGATGAGMGHLVAMDDNAAELA
LSHYSIELWRALSGEMPDGCAYRNCGTLWLAADAHEMDLARAKQATLAAHGVAGELIDAA
ALAQLEPMLRAGLGGALKIPGDAILYAPVTANWLLQRAPRVTVRRERAVAVDGPSVTLAS
GDVLRAERVVVANGVAARTLLPELPLRPKKGHLLITDRYPGHVSHQLVELGYAASAHASD
GTSVAFNVQPRPTGQLLIGSSRQFDTEDAQVEPPVLARMLRRAVGYLPALADLNGIRAWT
GFRSASPDGLPLLGEHPARPGVWLAVGHEGLGVTTAPGSARLVAALMAGERPPIEIEPYL
PGRFLTASPVAGALT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaaacgaagaccgacgtcgtcgtgatcggcgccggcatcgtcggcgcggcgtgc
gcgcacgaactcgcgcagcgcgggctgcgcgtgctcgtcgtcgacgacgcgagcggcggc
gcgaccggcgcgggcatggggcacctcgtcgcgatggacgacaacgcggcggagctcgcg
ctgagccattactcgatcgaattgtggcgcgcgttgagcggcgagatgcccgacggctgc
gcataccgcaactgcggcacgctgtggctcgcggccgatgcgcacgagatggatctggcg
cgcgcgaagcaggcgacgctcgccgcgcacggcgtggccggcgagctgatcgacgcggcg
gcgctcgcgcaactggagccgatgctgcgcgcgggcctcggcggcgcgctgaagattccg
ggcgacgcgattctctacgcacccgtcaccgcgaactggctgctgcagcgcgcgccgcgc
gtcacggtgcgccgcgagcgggccgtcgcggtcgatggcccgagcgtgacgctcgcaagc
ggcgacgtgctgcgcgcggagcgcgtggtggtcgcgaacggcgtcgcggcgcgtacgctg
ctgcccgaattgccgctgcgcccgaaaaaagggcatctgctgattaccgaccgctatccg
ggccatgtgtcgcaccagctcgtcgagctgggctatgcggcgagcgcgcacgcgagcgac
ggcacgtcggtcgcgttcaacgtgcagccgcggccgaccggtcagttgctgatcggctcg
tcgcgccagttcgacaccgaggacgcgcaggtcgagccgcccgtgctcgcgcgcatgctg
cgccgcgcggtcggctatctgcctgcgctggccgacctgaacggcatccgtgcctggacc
ggctttcgctccgcgagtcccgacggcctgccgctgctcggcgagcacccggcgcggccg
ggcgtgtggctcgcggtcgggcacgaagggctcggcgtgacgaccgcgccgggcagcgcg
cggctcgtcgccgcgctgatggccggcgagcggccgcccatcgagatcgaaccgtatttg
ccgggacgcttcctgaccgcgtcccccgtagctggagcgctgacatga

DBGET integrated database retrieval system