KEGG   Burkholderia cenocepacia J2315: BCAM1268Help
Entry
BCAM1268          CDS       T00771                                 

Definition
putative FAD-binding oxidoreductase
Organism
bcj  Burkholderia cenocepacia J2315
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1394171..1395298
Genome map
AA seq 375 aa AA seqDB search
MSETKTDVVVIGAGIVGAACAHELAQRGLRVLVVDDASGGATGAGMGHLVAMDDNAAELA
LSHYSIELWRALSGEMPDGCAYRNCGTLWLAADAHEMDLARAKQATLAAHGVAGELIDAA
ALAQLEPMLRAGLGGALKIPGDAILYAPVTANWLLQRAPRVTVRRERAVAVDGPSVTLAS
GDVLRAERVVVANGVAARTLLPELPLRPKKGHLLITDRYPGHVSHQLVELGYAASAHASD
GTSVAFNVQPRPTGQLLIGSSRQFDTEDAQVEPPVLARMLRRAVGYLPALADLNGIRAWT
GFRSASPDGLPLLGEHPARPGVWLAVGHEGLGVTTAPGSARLVAALMAGERPPIEIEPYL
PGRFLTASPVAGALT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaaacgaagaccgacgtcgtcgtgatcggcgccggcatcgtcggcgcggcgtgc
gcgcacgaactcgcgcagcgcgggctgcgcgtgctcgtcgtcgacgacgcgagcggcggc
gcgaccggcgcgggcatggggcacctcgtcgcgatggacgacaacgcggcggagctcgcg
ctgagccattactcgatcgaattgtggcgcgcgttgagcggcgagatgcccgacggctgc
gcataccgcaactgcggcacgctgtggctcgcggccgatgcgcacgagatggatctggcg
cgcgcgaagcaggcgacgctcgccgcgcacggcgtggccggcgagctgatcgacgcggcg
gcgctcgcgcaactggagccgatgctgcgcgcgggcctcggcggcgcgctgaagattccg
ggcgacgcgattctctacgcacccgtcaccgcgaactggctgctgcagcgcgcgccgcgc
gtcacggtgcgccgcgagcgggccgtcgcggtcgatggcccgagcgtgacgctcgcaagc
ggcgacgtgctgcgcgcggagcgcgtggtggtcgcgaacggcgtcgcggcgcgtacgctg
ctgcccgaattgccgctgcgcccgaaaaaagggcatctgctgattaccgaccgctatccg
ggccatgtgtcgcaccagctcgtcgagctgggctatgcggcgagcgcgcacgcgagcgac
ggcacgtcggtcgcgttcaacgtgcagccgcggccgaccggtcagttgctgatcggctcg
tcgcgccagttcgacaccgaggacgcgcaggtcgagccgcccgtgctcgcgcgcatgctg
cgccgcgcggtcggctatctgcctgcgctggccgacctgaacggcatccgtgcctggacc
ggctttcgctccgcgagtcccgacggcctgccgctgctcggcgagcacccggcgcggccg
ggcgtgtggctcgcggtcgggcacgaagggctcggcgtgacgaccgcgccgggcagcgcg
cggctcgtcgccgcgctgatggccggcgagcggccgcccatcgagatcgaaccgtatttg
ccgggacgcttcctgaccgcgtcccccgtagctggagcgctgacatga

DBGET integrated database retrieval system